Sequences
EST Library Info
sme1M. Semimembranosus
tra1Trachea
Clusters
Oligos
SNPs

Gene ID ENSG00000168228 (click for geneview)
Transcript ID ENST00000302874(link to ensembl)
Symbol ZCCHC4
Localtion Chromosome:4:25023448:25048272:1 band: 4p15.2
Description Zinc finger CCHC domain containing protein 4. [Source:Uniprot/SWISSPROT;Acc:Q9H5U6]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-------------------------------------------------------><------------------------------------------
-M--E--D--S--F--C--H--Y--N--M--F--N--H--H--F--F--D--G--K--T--A--L--E--V--C--R--A--F--L--Q--E--D--K--
ATGGAAGATAGCTTTTGCCATTATAATATGTTTAACCATCATTTCTTTGATGGAAAGACTGCCCTTGAAGTATGCAGAGCATTTTTACAGGAAGATAAAG
                                                            :::::::: ::.::::::.:.:::.: :::::::::::::
------------------------------------------------------------GCCCTTGACGTGTGCAGAACGTTTCTCCAGGAAGATAAAG
-------------------------------------------------------------A--L--D--V--C--R--T--F--L--Q--E--D--K--

----------------------------------------------------------------------------------------------------
G--E--G--I--I--M--V--T--D--P--P--F--G--G--L--V--E--P--L--A--I--T--F--K--K--L--I--A--M--W--K--E--G--Q
GCGAAGGAATCATTATGGTGACGGATCCTCCGTTTGGTGGCTTGGTTGAACCTCTGGCTATTACATTCAAGAAGTTAATTGCTATGTGGAAAGAAGGTCA
:.::::::.:::::::::::::.:::::::: :::::::::::::::::::::::::::.::::::::::::::::::::::::::::::::::::::::
GTGAAGGAGTCATTATGGTGACAGATCCTCCCTTTGGTGGCTTGGTTGAACCTCTGGCTGTTACATTCAAGAAGTTAATTGCTATGTGGAAAGAAGGTCA
G--E--G--V--I--M--V--T--D--P--P--F--G--G--L--V--E--P--L--A--V--T--F--K--K--L--I--A--M--W--K--E--G--Q

-------><-------------------------------------------------------------------------------------------
--S--Q--D--D--S--H--K--E--L--P--I--F--W--I--F--P--Y--F--F--E--S--R--I--C--Q--F--F--P--S--F--Q--M--L-
AAGCCAAGATGACAGTCACAAAGAACTACCCATTTTCTGGATTTTCCCCTATTTTTTTGAATCCCGAATTTGTCAGTTTTTTCCAAGCTTCCAGATGCTG
:         .::.::::: :::::.::::::: :::::::::::::::::::::::.::: :::::::::::::::::::.:::::::::.. ::::::
A---------AACGGTCACNAAGAATTACCCATATTCTGGATTTTCCCCTATTTTTTCGAAGCCCGAATTTGTCAGTTTTTCCCAAGCTTCTGCATGCTG
-----------N--G--H--X--E--L--P--I--F--W--I--F--P--Y--F--F--E--A--R--I--C--Q--F--F--P--S--F--C--M--L-

--------><------------------------------------------------------------------------------------------
-D--Y--Q--V--D--Y--D--N--H--A--L--Y--K--H--G--K--T--G--R--K--Q--S--P--V--R--I--F--T--N--I--P--P--N--
GATTACCAGGTAGATTATGATAATCATGCACTTTATAAACACGGAAAGACAGGTCGAAAACAGTCTCCCGTGCGTATTTTCACCAACATTCCGCCCAACA
:::::::::::::::::::::::::::::::::::::::::.::::::: ::: ::.:::::.:::::.::::: :::::::::::.::.::::::::::
GATTACCAGGTAGATTATGATAATCATGCACTTTATAAACATGGAAAGAGAGGGCGGAAACAATCTCCTGTGCGGATTTTCACCAATATCCCGCCCAACA
-D--Y--Q--V--D--Y--D--N--H--A--L--Y--K--H--G--K--R--G--R--K--Q--S--P--V--R--I--F--T--N--I--P--P--N--

------------------------------><--------------------------------------------------------------------
K--I--I--L--P--T--E--E--G--Y--R--F--C--S--P--C--Q--R--Y--V--S--L--E--N--Q--H--C--E--L--C--N--S--C--T
AAATAATCCTTCCTACTGAAGAAGGGTACAGATTTTGCTCTCCGTGTCAACGGTATGTTTCTCTAGAGAATCAACACTGTGAGCTCTGTAATTCTTGCAC
:::::.:::::::.:.::::::::::      :::::.::::.:::::::::.::::::::: :::::::::::::::::::.: :::::::::::::::
AAATAGTCCTTCCCATTGAAGAAGGG------TTTTGTTCTCTGTGTCAACGATATGTTTCTGTAGAGAATCAACACTGTGAACACTGTAATTCTTGCAC
K--I--V--L--P--I--E--E--G--------F--C--S--L--C--Q--R--Y--V--S--V--E--N--Q--H--C--E--H--C--N--S--C--T

------><--------------------------------------------------><----------------------------------------
--S--K--D--G--R--K--W--N--H--C--F--L--C--K--K--C--V--K--P--S--W--I--H--C--S--I--C--N--H--C--A--V--P-
ATCCAAGGATGGCAGGAAATGGAACCATTGCTTTCTCTGTAAAAAGTGTGTAAAGCCTTCCTGGATCCACTGTAGCATCTGCAATCACTGTGCTGTTCCA
:::::::::::::::.:::::::::::::::::::::::.::::::::::::::::::   :::::::::::::..:..::::.::::::.:.: :::::
ATCCAAGGATGGCAGAAAATGGAACCATTGCTTTCTCTGCAAAAAGTGTGTAAAGCCT---TGGATCCACTGTAATACTTGCAGTCACTGCGTTCTTCCA
--S--K--D--G--R--K--W--N--H--C--F--L--C--K--K--C--V--K--P-----W--I--H--C--N--T--C--S--H--C--V--L--P-

----------------------------------------------------------------------------------------------------
-D--H--S--C--E--G--P--K--H--G--C--F--I--C--G--E--L--D--H--K--R--S--T--C--P--N--I--A--T--S--K--R--A--
GATCATTCTTGTGAGGGCCCCAAACATGGCTGCTTTATTTGTGGTGAACTGGATCATAAACGCAGTACTTGTCCTAACATTGCTACATCTAAGAGAGCTA
:::::::::::. :::::::.::: :.:::::::::::::::::::::.:.:::::::::::::::::::::::.:::::. .::::   ::::.::.::
GATCATTCTTGCCAGGGCCCTAAAGACGGCTGCTTTATTTGTGGTGAATTAGATCATAAACGCAGTACTTGTCCCAACATCTTTACAAGGAAGAAAGTTA
-D--H--S--C--Q--G--P--K--D--G--C--F--I--C--G--E--L--D--H--K--R--S--T--C--P--N--I--F--T--R--K--K--V--

---><-----------------------------------------------------------------------------------------------
N--K--A--V--R--K--Q--K--Q--R--K--S--N--K--M--K--M--E--T--T--K--G--Q--S--M--N--H--T--S--A--T--R--R--K
ACAAAGCTGTCAGAAAGCAGAAGCAAAGAAAAAGTAATAAGATGAAAATGGAGACCACGAAAGGACAATCCATGAATCATACATCTGCTACAAGGAGAAA
::   :::::::::::::::::::: ::::::::.:.::::::::::::::::::::: ::::::::::::::::::::::::::::.::::::::..::
AC---GCTGTCAGAAAGCAGAAGCACAGAAAAAGCAGTAAGATGAAAATGGAGACCACTAAAGGACAATCCATGAATCATACATCTGTTACAAGGAAGAA
N-----A--V--R--K--Q--K--H--R--K--S--S--K--M--K--M--E--T--T--K--G--Q--S--M--N--H--T--S--V--T--R--K--K

--------------------------------------->
--K--R--R--E--R--A--H--Q--Y--L--G--S--*-
GAAAAGGAGGGAAAGAGCCCATCAATATCTTGGCTCTTAA
:::::::::.::::::::::::::::::.:: ::::::::
GAAAAGGAGAGAAAGAGCCCATCAATATTTTTGCTCTTAA
--K--R--R--E--R--A--H--Q--Y--F--C--S--*-

Pig Consensus Sequence

>BGISUST0000889963
------------------------------------------------------------GCCCTTGACGTGTGCAGAACGTTTCTCCAGGAAGATAAAG
GTGAAGGAGTCATTATGGTGACAGATCCTCCCTTTGGTGGCTTGGTTGAACCTCTGGCTGTTACATTCAAGAAGTTAATTGCTATGTGGAAAGAAGGTCA
A---------AACGGTCACNAAGAATTACCCATATTCTGGATTTTCCCCTATTTTTTCGAAGCCCGAATTTGTCAGTTTTTCCCAAGCTTCTGCATGCTG
GATTACCAGGTAGATTATGATAATCATGCACTTTATAAACATGGAAAGAGAGGGCGGAAACAATCTCCTGTGCGGATTTTCACCAATATCCCGCCCAACA
AAATAGTCCTTCCCATTGAAGAAGGG------TTTTGTTCTCTGTGTCAACGATATGTTTCTGTAGAGAATCAACACTGTGAACACTGTAATTCTTGCAC
ATCCAAGGATGGCAGAAAATGGAACCATTGCTTTCTCTGCAAAAAGTGTGTAAAGCCT---TGGATCCACTGTAATACTTGCAGTCACTGCGTTCTTCCA
GATCATTCTTGCCAGGGCCCTAAAGACGGCTGCTTTATTTGTGGTGAATTAGATCATAAACGCAGTACTTGTCCCAACATCTTTACAAGGAAGAAAGTTA
AC---GCTGTCAGAAAGCAGAAGCACAGAAAAAGCAGTAAGATGAAAATGGAGACCACTAAAGGACAATCCATGAATCATACATCTGTTACAAGGAAGAA
GAAAAGGAGAGAAAGAGCCCATCAATATTTTTGCTCTTAA


>BGISUSP0000889963
--------------------ALDVCRTFLQEDKGEGVIMVTDPPFGGLVEPLAVTFKKLIAMWKEGQ---NGH-ELPIFWIFPYFFEARICQFFPSFCML
DYQVDYDNHALYKHGKRGRKQSPVRIFTNIPPNKIVLPIEEG--FCSLCQRYVSVENQHCEHCNSCTSKDGRKWNHCFLCKKCVKP-WIHCNTCSHCVLP
DHSCQGPKDGCFICGELDHKRSTCPNIFTRKKVN-AVRKQKHRKSSKMKMETTKGQSMNHTSVTRKKKRRERAHQYFCS*