Sequences
EST Library Info
cbr5Brain - RNA from China
spl1Spleen
tra2Trachea
uio1Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000111554 (click for geneview)
Transcript ID ENST00000303145(link to ensembl)
Symbol NP_059136.1
Localtion Chromosome:12:66974613:67012379:-1 band: 12q15
Description Mdm4, transformed 3T3 cell double minute 1, p53 binding protein
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<----------------><---------------------------------------------------------------------------------
-M--P--V--R--F--K--G--L--S--E--Y--Q--R--N--F--L--W--K--K--S--Y--L--S--E--S--C--N--S--S--V--G--R--K--
ATGCCGGTGCGCTTCAAGGGGCTGAGTGAATACCAGAGGAACTTCCTGTGGAAAAAGTCTTATTTGTCCGAGTCTTGTAATTCCTCCGTGGGGCGAAAGT
                  :::.::::::::::::::::.:::::.:::::::::::::: :::::::: :::::.:.::::.:::: ::::::::::.::
------------------GGGTTGAGTGAATACCAGAGAAACTTTCTGTGGAAAAAGTCATATTTGTCAGAGTCCTATAATCCCTCAGTGGGGCGAAGGT
-------------------G--L--S--E--Y--Q--R--N--F--L--W--K--K--S--Y--L--S--E--S--Y--N--P--S--V--G--R--R--

--------------------------------><------------------------------------------------------------------
Y--P--W--A--G--L--R--S--D--Q--L--G--I--T--K--E--P--S--F--I--S--K--R--R--V--P--Y--H--D--P--Q--I--S--K
ACCCATGGGCTGGACTTAGATCAGATCAATTAGGCATCACGAAAGAGCCAAGTTTTATTTCAAAAAGAAGAGTCCCTTACCATGACCCACAGATTTCAAA
::::::::::.::::::::.::::::::::::   :::::.:::::::::::::::::::: :::::::::::.:::.::::.:::::::::::::::::
ACCCATGGGCCGGACTTAGGTCAGATCAATTA---ATCACAAAAGAGCCAAGTTTTATTTCCAAAAGAAGAGTTCCTCACCACGACCCACAGATTTCAAA
Y--P--W--A--G--L--R--S--D--Q--L-----I--T--K--E--P--S--F--I--S--K--R--R--V--P--H--H--D--P--Q--I--S--K

----------------------------------------------------------------------------------------------------
--S--L--E--W--N--G--A--I--S--E--S--N--V--V--A--S--P--E--P--E--A--P--E--T--P--K--S--Q--E--A--E--Q--K-
ATCTCTGGAGTGGAATGGAGCTATCTCAGAGAGCAATGTGGTTGCATCACCAGAACCAGAAGCCCCGGAAACACCAAAATCACAAGAAGCAGAACAAAAG
.::::: ::::::::::::::::. :::::::. .:::::::: .:::::::::::: :::: ::: ..:::::::.:::::::.::.:::::: ::::.
GTCTCTTGAGTGGAATGGAGCTACGTCAGAGAAGGATGTGGTTCTATCACCAGAACCTGAAGGCCCCAGAACACCAGAATCACAGGAGGCAGAAAAAAAA
--S--L--E--W--N--G--A--T--S--E--K--D--V--V--L--S--P--E--P--E--G--P--R--T--P--E--S--Q--E--A--E--K--K-

----------------------------------------------------------------------------------------------------
----D--V--T--Q--E--R--V--H--S--L--E--A--S--R--V--P--K--R--T--R--S--H--S--A--D--S--R--A--E--G--A--S--
---GATGTTACTCAAGAAAGAGTTCACTCACTAGAAGCTTCCAGGGTTCCCAAAAGAACCAGATCTCACTCTGCAGACTCCAGAGCTGAAGGGGCTTCAG
   :::.::: .:::::::::::::   ::::::::::::: :::::::::::.:::::::::::::::::::: :::::::::::::::::::::::::
GAAGATATTAACCAAGAAAGAGTTCTAGCACTAGAAGCTTCAAGGGTTCCCAAGAGAACCAGATCTCACTCTGCCGACTCCAGAGCTGAAGGGGCTTCAG
-E--D--I--N--Q--E--R--V--L--A--L--E--A--S--R--V--P--K--R--T--R--S--H--S--A--D--S--R--A--E--G--A--S--

----------------------------------------------------------------------------------------------------
D-----V--E--N--N--E--G--V--T-----N--H--T--P--V--N--E--N--V--E--L--E--H--S--T--K--V--L--S--E--N--V--D
AT---GTGGAAAATAATGAGGGTGTAACA---AACCATACACCAGTTAATGAAAATGTGGAACTGGAACATTCTACCAAGGTTCTTTCAGAAAATGTAGA
:.   ::::::::::: ::::.:.::.::   ::::::...:::::::.::::::::::::::::::::::::::::::: ::::.::::::::.:::::
ACATTGTGGAAAATAAGGAGGATATAGCAGCAAACCATGTGCCAGTTAGTGAAAATGTGGAACTGGAACATTCTACCAAGCTTCTCTCAGAAAACGTAGA
D--I--V--E--N--K--E--D--I--A--A--N--H--V--P--V--S--E--N--V--E--L--E--H--S--T--K--L--L--S--E--N--V--D

------><--------------------------------------------------------------------------------------------
--N--G--L--D--R--L--L--R--K--K--A--G--L--T--V--V--P--S--Y--N--A--L--R--N--S--E--Y--Q--R--Q--F--V--W-
TAATGGGTTGGATAGACTTCTGCGTAAGAAAGCTGGATTGACTGTTGTTCCTTCATATAATGCCTTGAGAAATTCTGAATATCAAAGGCAGTTTGTTTGG
:.::::::::::::::::::: :: ::::::::::::::::::::::::::. ::..::::.::::::::::::::::::::::::::::::::::::::
TGATGGGTTGGATAGACTTCTCCGGAAGAAAGCTGGATTGACTGTTGTTCCCACACGTAATACCTTGAGAAATTCTGAATATCAAAGGCAGTTTGTTTGG
--D--G--L--D--R--L--L--R--K--K--A--G--L--T--V--V--P--T--R--N--T--L--R--N--S--E--Y--Q--R--Q--F--V--W-

-----------------------------------------><---------------------------------------------------------
-K--T--S--K--E--T--A--P--A--F--A--A--N--Q--V--F--H--N--K--S--Q--F--V--P--P--F--K--G--N--S--V--I--H--
AAGACTTCTAAAGAAACTGCTCCAGCTTTTGCAGCCAATCAGGTTTTCCACAATAAAAGCCAGTTTGTTCCACCATTCAAAGGTAACTCAGTCATCCATG
:::::..:::::::::::::::::::::::::::::::::::      :::::::::::: :.:::::::::: ::::::::::::::: ::::::::::
AAGACCCCTAAAGAAACTGCTCCAGCTTTTGCAGCCAATCAG------CACAATAAAAGCAAATTTGTTCCACAATTCAAAGGTAACTCTGTCATCCATG
-K--T--P--K--E--T--A--P--A--F--A--A--N--Q--------H--N--K--S--K--F--V--P--Q--F--K--G--N--S--V--I--H--

----------------------------------------------------------------------------------------------------
E--T--E--Y--K--R--N--F--K--G--L--S--P--V--K--E--P--K--L--R--N--D--L--R--E--N--R--N--L--E--T--V--S--P
AAACTGAATACAAAAGAAATTTCAAGGGTTTATCTCCAGTGAAAGAACCAAAATTAAGAAATGATTTGAGAGAAAACAGAAATCTTGAAACAGTGTCTCC
:::::::.::::::::::::::.::::::::::::::::::::::::::::::::::::::::::::::..::.:::::::::.::::::.:.:.:::::
AAACTGAGTACAAAAGAAATTTTAAGGGTTTATCTCCAGTGAAAGAACCAAAATTAAGAAATGATTTGAAGGAGAACAGAAATTTTGAAATAATATCTCC
E--T--E--Y--K--R--N--F--K--G--L--S--P--V--K--E--P--K--L--R--N--D--L--K--E--N--R--N--F--E--I--I--S--P

---------><-----------------------------------------------------------------------------------------
--E--R--K--S--N--K--I--D--D--R--L--K--L--E--A--E--M--E--L--K--D--L--H--Q--P--K--R--K--L--T--P--W--K-
TGAAAGGAAGAGTAATAAAATAGACGATCGTTTAAAATTGGAAGCAGAGATGGAATTAAAAGACTTACACCAGCCTAAAAGGAAGCTTACTCCTTGGAAA
:::::.::::   :::::::.:::.:::: :::::::::.::::::::::::::::.::::::::.: ::::::::::::.:::: ::::::::::::::
TGAAAAGAAG---AATAAAACAGATGATCCTTTAAAATTAGAAGCAGAGATGGAATCAAAAGACTCAAACCAGCCTAAAAAGAAGGTTACTCCTTGGAAA
--E--K--K-----N--K--T--D--D--P--L--K--L--E--A--E--M--E--S--K--D--S--N--Q--P--K--K--K--V--T--P--W--K-

-------------><-------------------------------------------------------------------------------------
-H--Q--R--L--G--K--V--N--S--E--Y--R--A--K--F--L--S--P--A--Q--Y--L--Y--K--A--G--A--W--T--H--V--K--G--
CATCAAAGGCTTGGGAAGGTGAATTCCGAATATAGAGCAAAATTTCTGAGCCCAGCTCAGTATTTATATAAAGCTGGGGCTTGGACACATGTAAAGGGAA
::::::::::::   :::::::::::.::::::::::::::::::::::::::: :.:::::::::::::::::::::::::::::::.::::::::.::
CATCAAAGGCTT---AAGGTGAATTCTGAATATAGAGCAAAATTTCTGAGCCCATCCCAGTATTTATATAAAGCTGGGGCTTGGACACGTGTAAAGGAAA
-H--Q--R--L-----K--V--N--S--E--Y--R--A--K--F--L--S--P--S--Q--Y--L--Y--K--A--G--A--W--T--R--V--K--E--

-------------><-------------------------------------------------------------------------------------
N--M--P--N--Q--V--K--E--L--R--E--K--A--E--F--Y--R--K--R--V--Q--G--T--H--F--S--R--D--H--L--N--Q--I--L
ACATGCCAAATCAGGTTAAAGAACTCCGAGAAAAGGCTGAGTTTTATAGGAAGCGAGTTCAGGGGACGCATTTTTCTCGGGACCATCTGAATCAGATTTT
::::.:::::::::::::::::::: :::::.::::::::::::::::::::.:::::::::::.::.::::::::::::::::::.:::::::::::.:
ACATACCAAATCAGGTTAAAGAACTGCGAGAGAAGGCTGAGTTTTATAGGAAACGAGTTCAGGGAACACATTTTTCTCGGGACCATTTGAATCAGATTCT
N--I--P--N--Q--V--K--E--L--R--E--K--A--E--F--Y--R--K--R--V--Q--G--T--H--F--S--R--D--H--L--N--Q--I--L

-----------------------------------------------------------------------------------------><---------
--S--D--S--N--C--C--W--D--V--S--S--T--T--S--S--E--G--T--V--S--S--N--I--R--A--L--D--L--A--G--D--P--T-
ATCTGATAGCAACTGCTGTTGGGATGTCTCCTCAACCACAAGCTCAGAAGGAACCGTTAGTAGCAACATCAGAGCATTAGATCTTGCTGGAGATCCTACA
.:::::::.::::.::::::::::::::::.::.:::::.:::::::::::::::.:::::::::::::.::::: .:::::::::::            
GTCTGATAACAACCGCTGTTGGGATGTCTCTTCGACCACGAGCTCAGAAGGAACCATTAGTAGCAACATTAGAGCCCTAGATCTTGCT------------
--S--D--N--N--R--C--W--D--V--S--S--T--T--S--S--E--G--T--I--S--S--N--I--R--A--L--D--L--A-------------

----------------------------------------------------------------------------------------------------
-S--H--K--T--L--Q--K--C--P--S--T--E--P--E--E--K--G--N--I--V--E--E--Q--P--Q--K--N--T--T--E--K--L--G--
AGCCATAAGACTTTGCAGAAATGTCCTTCTACAGAACCAGAAGAAAAAGGAAATATCGTGGAAGAACAGCCCCAGAAAAATACCACGGAGAAATTGGGTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
V--S--A--P--T--I--P--V--R--R--R--L--A--W--D--T--E--N--T--S--E--D--V--Q--K--Q--P--G--E--K--E--E--E--D
TGTCAGCTCCCACCATACCCGTTAGAAGGCGGCTGGCTTGGGATACAGAGAACACAAGTGAAGACGTACAGAAACAGCCCGGGGAGAAAGAGGAGGAGGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--D--N--E--E--E--G--D--R--K--T--G--K--Q--A--F--M--G--E--Q--E--K--L--D--V--R--E--K--S--K--A--D--K--M-
CGACAATGAAGAGGAAGGGGACAGGAAAACGGGCAAGCAGGCTTTTATGGGAGAGCAAGAGAAGTTGGATGTACGTGAGAAATCTAAGGCAGATAAGATG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------><-------------------------------------------------------------------------------------------
-K--E--G--S--D--S--S--V--S--S--E--K--G--G--R--L--P--T--P--K--L--R--E--L--G--G--I--Q--R--T--H--H--D--
AAAGAAGGGTCAGATTCTTCTGTATCCTCAGAAAAAGGAGGCCGGCTTCCTACTCCCAAGCTGAGAGAACTTGGTGGAATCCAGAGGACTCATCATGATC
               ::::::::.::.::::.::::::.::  :: :::::::::: :::.:.::::::::::: :::::::::::::::::.::.::::
---------------TCTTCTGTGTCTTCAGGAAAAGGGGGGAGGGTTCCTACTCCGAAGTTAAGAGAACTTGGAGGAATCCAGAGGACTCACCACGATC
----------------S--S--V--S--S--G--K--G--G--R--V--P--T--P--K--L--R--E--L--G--G--I--Q--R--T--H--H--D--

-----------------><---------------------------------------------------------------------------------
L--T--T--P--A--V--G--G--A--V--L--V--S--P--S--K--M--K--P--P--A--P--E--Q--R--K--R--M--T--S--Q--D--C--L
TCACTACTCCAGCTGTTGGTGGTGCTGTTTTAGTGTCTCCATCTAAGATGAAGCCTCCAGCCCCAGAACAGAGGAAAAGAATGACCTCTCAGGATTGTTT
:.::.::::::::::::   ::::::::.:::::::::::::::::..::::::::::::.:::::::::::.::::::::.. ::::::::::: :.::
TTACCACTCCAGCTGTT---GGTGCTGTCTTAGTGTCTCCATCTAAAGTGAAGCCTCCAGTCCCAGAACAGAAGAAAAGAACATCCTCTCAGGATGGCTT
L--T--T--P--A--V-----G--A--V--L--V--S--P--S--K--V--K--P--P--V--P--E--Q--K--K--R--T--S--S--Q--D--G--L

---------------------------><-----------------------------------------------------------------------
--E--T--S--K--N--D--F--T--K--K--E--S--R--A--V--S--L--L--T--S--P--A--A--G--I--K--T--V--D--P--L--P--L-
AGAAACTTCAAAGAATGATTTTACTAAGAAAGAAAGTCGTGCTGTATCCCTACTGACTTCTCCAGCTGCTGGTATAAAAACAGTTGATCCTCTGCCTTTG
::::.:::..:::::::::::::  :::::.::::::::::::.::::::: ::::::::::::::::::::: ::::::::::::::::.::::::: :
AGAAGCTTTGAAGAATGATTTTAGGAAGAAGGAAAGTCGTGCTATATCCCTTCTGACTTCTCCAGCTGCTGGTTTAAAAACAGTTGATCCCCTGCCTTGG
--E--A--L--K--N--D--F--R--K--K--E--S--R--A--I--S--L--L--T--S--P--A--A--G--L--K--T--V--D--P--L--P--W-

----------------------------------------------------------------------------------------------------
-R--E--D--S--E--D--N--I--H--K--F--A--E--A--T--L--P--V--S--K--I--P--K--Y--P--T--N--P--P--G--Q--L--P--
CGGGAAGATTCTGAAGACAATATCCACAAATTTGCTGAGGCAACTCTTCCAGTTTCAAAAATTCCAAAATACCCAACAAATCCCCCTGGACAGTTGCCTT
 ::::::::::::::  :::::::. ::.::.::::::::::::::::::::::::::::::::::.: ::.::::::::. : ::....::::. ::::
AGGGAAGATTCTGAACCCAATATCTCCAGATCTGCTGAGGCAACTCTTCCAGTTTCAAAAATTCCAGACTATCCAACAAACACACCCAAGCAGTCTCCTT
-R--E--D--S--E--P--N--I--S--R--S--A--E--A--T--L--P--V--S--K--I--P--D--Y--P--T--N--T--P--K--Q--S--P--

--------------------------------------------------------------------------------><------------------
S--P--P--H--V--P--S--Y--W--H--P--S--R--R--I--Q--G--S--L--R--D--P--E--F--Q--H--N--V--G--K--A--R--M--N
CTCCACCACATGTTCCATCCTACTGGCATCCCTCTCGACGAATTCAGGGCTCTCTTAGAGATCCAGAGTTTCAGCACAATGTGGGAAAAGCAAGGATGAA
::::::: ..::..:::::::::::::::::  :::: ::::::::::::::.:: :::::.:::::.::::::::.:::   :::::: ::::::::::
CTCCACCCTGTGCCCCATCCTACTGGCATCCAGCTCGTCGAATTCAGGGCTCCCTGAGAGACCCAGAATTTCAGCATAAT---GGAAAATCAAGGATGAA
S--P--P--C--A--P--S--Y--W--H--P--A--R--R--I--Q--G--S--L--R--D--P--E--F--Q--H--N-----G--K--S--R--M--N

----------------------------------------><----------------------------------------------------------
--N--L--Q--L--P--Q--H--E--A--F--N--D--E--D--E--D--R--L--S--E--I--S--A--R--S--A--A--S--S--L--R--A--F-
CAATTTGCAGTTACCTCAACATGAAGCCTTTAATGATGAAGATGAGGACAGATTGTCTGAGATTTCTGCTCGCTCTGCAGCTTCTAGTCTCCGGGCTTTT
.::::: :::::::::::.:::::::::::::::::::::   ::.::::::::.:::::::::::::::::.:::::::::::::::::.:::::::::
TAATTTCCAGTTACCTCAGCATGAAGCCTTTAATGATGAA---GAAGACAGATTATCTGAGATTTCTGCTCGTTCTGCAGCTTCTAGTCTTCGGGCTTTT
--N--F--Q--L--P--Q--H--E--A--F--N--D--E-----E--D--R--L--S--E--I--S--A--R--S--A--A--S--S--L--R--A--F-

----------------------------------------------------->
-Q--T--L--A--R--A--K--K--R--K--E--N--F--W--G--K--T--*-
CAAACTCTGGCACGAGCTAAGAAAAGGAAGGAGAATTTCTGGGGTAAAACATAA
::.::::::::::::::: :.:::::::::   :::::::::::.:::::.:::
CAGACTCTGGCACGAGCTCAAAAAAGGAAG---AATTTCTGGGGCAAAACGTAA
-Q--T--L--A--R--A--Q--K--R--K-----N--F--W--G--K--T--*-

Pig Consensus Sequence

>BGISUST0000895680
------------------GGGTTGAGTGAATACCAGAGAAACTTTCTGTGGAAAAAGTCATATTTGTCAGAGTCCTATAATCCCTCAGTGGGGCGAAGGT
ACCCATGGGCCGGACTTAGGTCAGATCAATTA---ATCACAAAAGAGCCAAGTTTTATTTCCAAAAGAAGAGTTCCTCACCACGACCCACAGATTTCAAA
GTCTCTTGAGTGGAATGGAGCTACGTCAGAGAAGGATGTGGTTCTATCACCAGAACCTGAAGGCCCCAGAACACCAGAATCACAGGAGGCAGAAAAAAAA
GAAGATATTAACCAAGAAAGAGTTCTAGCACTAGAAGCTTCAAGGGTTCCCAAGAGAACCAGATCTCACTCTGCCGACTCCAGAGCTGAAGGGGCTTCAG
ACATTGTGGAAAATAAGGAGGATATAGCAGCAAACCATGTGCCAGTTAGTGAAAATGTGGAACTGGAACATTCTACCAAGCTTCTCTCAGAAAACGTATT
GGATAGACTTCTCCGGAAGAAAGCTGGATTGACTGTTGTTCCCACACGTAATACCTTGAGAAATTCTGAATATCAAAGGCAGTTTGTTTGGAAGACCCCT
AAAGAAACTGCTCCAGCTTTTGCAGCCAATCAG------CACAATAAAAGCAAATTTGTTCCACAATTCAAAGGTAACTCTGTCATCCATGAAACTGAGT
ACAAAAGAAATTTTAAGGGTTTATCTCCAGTGAAAGAACCAAAATTAAGAAATGATTTGAAGGAGAACAGAAATTTTGAAATAATATCTCCTGAAAAGAA
G---AATAAAACAGATGATCCTTTAAAATTAGAAGCAGAGATGGAATCAAAAGACTCAAACCAGCCTAAAAAGAAGGTTACTCCTTGGAAACATCAAAGG
CTT---AAGGTGAATTCTGAATATAGAGCAAAATTTCTGAGCCCATCCCAGTATTTATATAAAGCTGGGGCTTGGACACGTGTAAAGGAAAACATACCAA
ATCAGGTTAAAGAACTGCGAGAGAAGGCTGAGTTTTATAGGAAACGAGTTCAGGGAACACATTTTTCTCGGGACCATTTGAATCAGATTCTGTCTGATAA
CAACCGCTGTTGGGATGTCTCTTCGACCACGAGCTCAGAAGGAACCATTAGTAGCAACATTAGAGCCCTAGATCTTGCT---------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
------TCTTCTGTGTCTTCAGGAAAAGGGGGGAGGGTTCCTACTCCGAAGTTAAGAGAACTTGGAGGAATCCAGAGGACTCACCACGATCTTACCACTC
CAGCTGTT---GGTGCTGTCTTAGTGTCTCCATCTAAAGTGAAGCCTCCAGTCCCAGAACAGAAGAAAAGAACATCCTCTCAGGATGGCTTAGAAGCTTT
GAAGAATGATTTTAGGAAGAAGGAAAGTCGTGCTATATCCCTTCTGACTTCTCCAGCTGCTGGTTTAAAAACAGTTGATCCCCTGCCTTGGAGGGAAGAT
TCTGAACCCAATATCTCCAGATCTGCTGAGGCAACTCTTCCAGTTTCAAAAATTCCAGACTATCCAACAAACACACCCAAGCAGTCTCCTTCTCCACCCT
GTGCCCCATCCTACTGGCATCCAGCTCGTCGAATTCAGGGCTCCCTGAGAGACCCAGAATTTCAGCATAAT---GGAAAATCAAGGATGAATAATTTCCA
GTTACCTCAGCATGAAGCCTTTAATGATGAA---GAAGACAGATTATCTGAGATTTCTGCTCGTTCTGCAGCTTCTAGTCTTCGGGCTTTTCAGACTCTG
GCACGAGCTCAAAAAAGGAAGAATTTCTGGGGCAAAACGTAA


>BGISUSP0000895680
------GLSEYQRNFLWKKSYLSESYNPSVGRRYPWAGLRSDQL-ITKEPSFISKRRVPHHDPQISKSLEWNGATSEKDVVLSPEPEGPRTPESQEAEKK
EDINQERVLALEASRVPKRTRSHSADSRAEGASDIVENKEDIAANHVPVSENVELEHSTKLLSENVLDRLLRKKAGLTVVPTRNTLRNSEYQRQFVWKTP
KETAPAFAANQ--HNKSKFVPQFKGNSVIHETEYKRNFKGLSPVKEPKLRNDLKENRNFEIISPEKK-NKTDDPLKLEAEMESKDSNQPKKKVTPWKHQR
L-KVNSEYRAKFLSPSQYLYKAGAWTRVKENIPNQVKELREKAEFYRKRVQGTHFSRDHLNQILSDNNRCWDVSSTTSSEGTISSNIRALDLA-------
----------------------------------------------------------------------------------------------------
--SSVSSGKGGRVPTPKLRELGGIQRTHHDLTTPAV-GAVLVSPSKVKPPVPEQKKRTSSQDGLEALKNDFRKKESRAISLLTSPAAGLKTVDPLPWRED
SEPNISRSAEATLPVSKIPDYPTNTPKQSPSPPCAPSYWHPARRIQGSLRDPEFQHN-GKSRMNNFQLPQHEAFNDE-EDRLSEISARSAASSLRAFQTL
ARAQKRKNFWGKT*