Sequences
EST Library Info
sme2M. Semimembranosus
Clusters
Oligos
SNPs

Gene ID ENSG00000168387 (click for geneview)
Transcript ID ENST00000303500(link to ensembl)
Symbol ASB14
Localtion Chromosome:3:57277419:57288020:-1 band: 3p14.3
Description Ankyrin repeat and SOCS box protein 14 (ASB-14). [Source:Uniprot/SWISSPROT;Acc:Q8WXK2]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--L--K--C--I--L--K--F--F--L--R--A--L--K--I--L--I--P--V--T--D--L--A--A--I--K--Q--S--G--I--S--P--V--
ATGTTGAAATGCATTTTGAAATTCTTTCTCAGAGCTCTAAAGATACTGATTCCAGTTACGGATCTTGCTGCCATTAAGCAGAGTGGGATCAGTCCAGTTC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
H--C--A--A--A--G--A--H--P--Q--C--L--E--L--L--I--Q--A--G--F--D--V--N--F--M--L--D--Q--R--I--N--K--H--Y
ACTGTGCAGCAGCAGGAGCACATCCTCAGTGCCTGGAACTCCTCATCCAGGCTGGATTTGATGTGAACTTCATGCTGGATCAGAGAATTAACAAACACTA
                 :::::.::. :.:::::::::::.:::::.:::::::::::::::::.::.::::::: .:::::::::::: .:::::::::
-----------------GCACACCCCAAATGCCTGGAACTTCTCATTCAGGCTGGATTTGATGTAAATTTCATGCGAGATCAGAGAATTCGCAAACACTA
------------------A--H--P--K--C--L--E--L--L--I--Q--A--G--F--D--V--N--F--M--R--D--Q--R--I--R--K--H--Y

----------------------------------------------------------------------------------------------------
--D--D--H--R--K--S--A--L--Y--F--A--V--S--N--S--D--L--S--S--V--K--L--L--L--S--A--G--A--L--P--N--Q--D-
CGATGACCACAGGAAGTCAGCTTTGTATTTTGCTGTATCAAACAGTGACCTCTCTTCAGTCAAGCTGCTTCTGAGTGCTGGAGCTCTGCCTAATCAAGAC
.:::::::::::::::::::::::::::::::::::::::::..::::::::::::::::.:::::.::::::::::::::::::::.::::::::::::
TGATGACCACAGGAAGTCAGCTTTGTATTTTGCTGTATCAAATGGTGACCTCTCTTCAGTTAAGCTACTTCTGAGTGCTGGAGCTCTACCTAATCAAGAC
--D--D--H--R--K--S--A--L--Y--F--A--V--S--N--G--D--L--S--S--V--K--L--L--L--S--A--G--A--L--P--N--Q--D-

----------------------------------------------------------------------------------------------------
-P--V--N--C--L--Q--I--A--L--R--M--G--N--Y--E--L--I--S--L--L--L--R--H--G--A--N--V--N--Y--F--C--R--V--
CCGGTTAACTGCCTCCAGATAGCCCTCAGGATGGGCAACTATGAGCTGATCAGTCTGCTGCTAAGGCATGGGGCCAATGTCAATTACTTCTGCAGAGTTA
::.::::::::::::::::::::::: ::::::::::::::::::::::: :::::::::::. ::::.::::::::.::::::::::::::.:::::.:
CCAGTTAACTGCCTCCAGATAGCCCTAAGGATGGGCAACTATGAGCTGATAAGTCTGCTGCTGCGGCACGGGGCCAACGTCAATTACTTCTGTAGAGTCA
-P--V--N--C--L--Q--I--A--L--R--M--G--N--Y--E--L--I--S--L--L--L--R--H--G--A--N--V--N--Y--F--C--R--V--

----------------------------------------------------------------------------------------------------
N--P--L--H--F--P--S--A--L--Q--Y--T--L--K--D--E--V--M--L--R--M--L--L--N--Y--G--Y--D--T--E--R--C--F--D
ACCCTTTACATTTCCCATCAGCACTGCAATACACTCTGAAAGATGAAGTCATGCTCAGGATGCTGCTGAACTATGGGTATGACACAGAGCGATGTTTTGA
::::::::::::::::.::::: ::::::::.:::::::::::::::::::::::::::::::::.::::.::::: :::::::::::::::::.:::::
ACCCTTTACATTTCCCGTCAGCTCTGCAATATACTCTGAAAGATGAAGTCATGCTCAGGATGCTGTTGAATTATGGCTATGACACAGAGCGATGCTTTGA
N--P--L--H--F--P--S--A--L--Q--Y--T--L--K--D--E--V--M--L--R--M--L--L--N--Y--G--Y--D--T--E--R--C--F--D

---------------------------------------------------------------------------><-----------------------
--C--P--H--G--D--K--V--H--P--S--Y--T--V--E--G--W--T--S--T--V--I--K--D--T--K--F--C--E--V--I--T--L--S-
TTGCCCACATGGAGACAAAGTCCATCCTTCCTATACTGTTGAAGGCTGGACATCTACAGTTATCAAAGATACTAAGTTCTGTGAAGTAATAACTTTGTCA
:::.:: ::::::::::::::.:::::::.::::: : ::::::::::::::::::: ::::::::::::      ::::::::::::::::::::::::
TTGTCCTCATGGAGACAAAGTTCATCCTTTCTATAGTTTTGAAGGCTGGACATCTACTGTTATCAAAGAT------TTCTGTGAAGTAATAACTTTGTCA
--C--P--H--G--D--K--V--H--P--F--Y--S--F--E--G--W--T--S--T--V--I--K--D--------F--C--E--V--I--T--L--S-

----------------------------------------------------------------------------------------------------
-W--L--Q--H--L--S--G--K--V--V--R--V--M--L--D--Y--V--D--Q--V--R--I--C--S--K--L--K--A--V--L--Q--K--Q--
TGGCTGCAACATCTCTCTGGAAAGGTTGTTCGAGTGATGCTTGATTATGTTGATCAAGTTCGGATCTGTTCAAAGTTGAAAGCTGTGCTCCAAAAACAGG
:::::.:::::::::::::::::::::::::::::::::::::::::.::::::::::::                                        
TGGCTACAACATCTCTCTGGAAAGGTTGTTCGAGTGATGCTTGATTACGTTGATCAAGTT----------------------------------------
-W--L--Q--H--L--S--G--K--V--V--R--V--M--L--D--Y--V--D--Q--V-----------------------------------------

-----------------------------><---------------------------------------------------------------------
G--I--W--S--E--I--H--F--I--L--T--N--P--R--S--L--K--H--L--C--R--L--K--I--R--K--C--M--G--R--L--H--L--R
GGATCTGGTCAGAAATACATTTTATCTTAACAAACCCTCGCTCCCTAAAACATTTGTGCCGCCTAAAGATCCGGAAATGCATGGGACGGTTACATTTGCG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--C--P--V--F--M--S--F--L--P--L--P--N--R--L--K--A--Y--V--L--Y--K--E--Y--D--L--Y--G--Q--G--I--F--T--G-
CTGCCCTGTCTTCATGTCATTTCTTCCATTACCCAATCGTCTAAAAGCATATGTCCTTTACAAAGAATACGACCTTTATGGACAAGGAATTTTTACAGGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------->
-T--W--*-
ACCTGGTAA
         
---------
---------

Pig Consensus Sequence

>BGISUST0000893775
----------------------------------------------------------------------------------------------------
-----------------GCACACCCCAAATGCCTGGAACTTCTCATTCAGGCTGGATTTGATGTAAATTTCATGCGAGATCAGAGAATTCGCAAACACTA
TGATGACCACAGGAAGTCAGCTTTGTATTTTGCTGTATCAAATGGTGACCTCTCTTCAGTTAAGCTACTTCTGAGTGCTGGAGCTCTACCTAATCAAGAC
CCAGTTAACTGCCTCCAGATAGCCCTAAGGATGGGCAACTATGAGCTGATAAGTCTGCTGCTGCGGCACGGGGCCAACGTCAATTACTTCTGTAGAGTCA
ACCCTTTACATTTCCCGTCAGCTCTGCAATATACTCTGAAAGATGAAGTCATGCTCAGGATGCTGTTGAATTATGGCTATGACACAGAGCGATGCTTTGA
TTGTCCTCATGGAGACAAAGTTCATCCTTTCTATAGTTTTGAAGGCTGGACATCTACTGTTATCAAAGAT------TTCTGTGAAGTAATAACTTTGTCA
TGGCTACAACATCTCTCTGGAAAGGTTGTTCGAGTGATGCTTGATTACGTTGATCAAGTT----------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
---------


>BGISUSP0000893775
---------------------------------------AHPKCLELLIQAGFDVNFMRDQRIRKHYDDHRKSALYFAVSNGDLSSVKLLLSAGALPNQD
PVNCLQIALRMGNYELISLLLRHGANVNYFCRVNPLHFPSALQYTLKDEVMLRMLLNYGYDTERCFDCPHGDKVHPFYSFEGWTSTVIKD--FCEVITLS
WLQHLSGKVVRVMLDYVDQV--------------------------------------------------------------------------------
---