Sequences
EST Library Info
cje1Jejunum - RNA from China
pigcb1Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000168421 (click for geneview)
Transcript ID ENST00000303700(link to ensembl)
Symbol RHOH
Localtion Chromosome:4:40021168:40068419:1 band: 4p14
Description Rho-related GTP-binding protein RhoH (GTP-binding protein TTF). [Source:Uniprot/SWISSPROT;Acc:Q15669]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--L--S--S--I--K--C--V--L--V--G--D--S--A--V--G--K--T--S--L--L--V--R--F--T--S--E--T--F--P--E--A--Y--
ATGCTGAGTTCCATCAAGTGCGTGTTGGTGGGCGACTCTGCTGTGGGGAAAACCTCTCTGTTGGTGCGCTTCACCTCCGAGACCTTCCCGGAGGCCTACA
:::::::::::::::::.::.::::::::::: :::::.:::::::::::::::::.:::::::::::::::::::::::.:::::::: :::  :::::
ATGCTGAGTTCCATCAAATGTGTGTTGGTGGGAGACTCCGCTGTGGGGAAAACCTCCCTGTTGGTGCGCTTCACCTCCGAAACCTTCCCCGAGCACTACA
-M--L--S--S--I--K--C--V--L--V--G--D--S--A--V--G--K--T--S--L--L--V--R--F--T--S--E--T--F--P--E--H--Y--

----------------------------------------------------------------------------------------------------
K--P--T--V--Y--E--N--T--G--V--D--V--F--M--D--G--I--Q--I--S--L--G--L--W--D--T--A--G--N--D--A--F--R--S
AGCCCACAGTGTACGAGAACACAGGGGTGGACGTCTTCATGGATGGCATCCAGATCAGCCTGGGCCTCTGGGACACAGCCGGCAATGACGCCTTCAGAAG
:::::::.::::::::::::::.:: :::::::::::::::::.:::::::::::::::::::::::::::::::::::.:::::.::::::::: :.::
AGCCCACGGTGTACGAGAACACGGGCGTGGACGTCTTCATGGACGGCATCCAGATCAGCCTGGGCCTCTGGGACACAGCTGGCAACGACGCCTTCCGGAG
K--P--T--V--Y--E--N--T--G--V--D--V--F--M--D--G--I--Q--I--S--L--G--L--W--D--T--A--G--N--D--A--F--R--S

----------------------------------------------------------------------------------------------------
--I--R--P--L--S--Y--Q--Q--A--D--V--V--L--M--C--Y--S--V--A--N--H--N--S--F--L--N--L--K--N--K--W--I--G-
CATCCGGCCCCTGTCCTACCAGCAGGCAGACGTGGTGCTGATGTGCTACTCTGTGGCCAACCATAACTCATTCCTGAACTTGAAGAACAAGTGGATTGGT
.::::: ::::::::::::::::::::.:::::::::::::::::::::::.::::::::..::::::: :::.::::::::::::::::::::::.:::
TATCCGCCCCCTGTCCTACCAGCAGGCGGACGTGGTGCTGATGTGCTACTCCGTGGCCAATTATAACTCCTTCTTGAACTTGAAGAACAAGTGGATCGGT
--I--R--P--L--S--Y--Q--Q--A--D--V--V--L--M--C--Y--S--V--A--N--Y--N--S--F--L--N--L--K--N--K--W--I--G-

----------------------------------------------------------------------------------------------------
-E--I--R--S--N--L--P--C--T--P--V--L--V--V--A--T--Q--T--D--Q--R--E--M--G--P--H--R--A--S--C--V--N--A--
GAAATTAGGAGCAACTTGCCCTGTACCCCTGTGCTGGTGGTGGCCACCCAGACTGACCAGCGGGAGATGGGGCCCCACAGGGCCTCCTGCGTCAATGCCA
:::.:.::::.::::.:::::::.:::::.:::.::::::::::::::::::: ::::::::::::.::::::::::: :::::::::::::::.::::.
GAAGTCAGGAACAACCTGCCCTGCACCCCCGTGTTGGTGGTGGCCACCCAGACGGACCAGCGGGAGGTGGGGCCCCACCGGGCCTCCTGCGTCAGTGCCG
-E--V--R--N--N--L--P--C--T--P--V--L--V--V--A--T--Q--T--D--Q--R--E--V--G--P--H--R--A--S--C--V--S--A--

----------------------------------------------------------------------------------------------------
M--E--G--K--K--L--A--Q--D--V--R--A--K--G--Y--L--E--C--S--A--L--S--N--R--G--V--Q--Q--V--F--E--C--A--V
TGGAAGGGAAGAAACTGGCCCAGGATGTCAGAGCCAAGGGCTACCTGGAGTGCTCAGCCCTTAGCAATCGGGGAGTACAGCAGGTGTTTGAGTGCGCCGT
:.::::: ::::.::::::::::::.:: :::::::::::::::.::::::::::::::::.:::::.:::::.::.:::::::::::::::::.:::::
TAGAAGGCAAGAGACTGGCCCAGGACGTGAGAGCCAAGGGCTACTTGGAGTGCTCAGCCCTCAGCAACCGGGGGGTGCAGCAGGTGTTTGAGTGTGCCGT
V--E--G--K--R--L--A--Q--D--V--R--A--K--G--Y--L--E--C--S--A--L--S--N--R--G--V--Q--Q--V--F--E--C--A--V

--------------------------------------------------------------------------->
--R--T--A--V--N--Q--A--R--R--R--N--R--R--R--L--F--S--I--N--E--C--K--I--F--*-
CCGAACTGCCGTCAACCAGGCCAGGAGACGAAACAGAAGGAGGCTCTTCTCCATCAATGAGTGCAAGATCTTCTAA
::::::::::::::::::.::::::::::: ::::::::::::.:::::.:  :.:::::::::::::::.::   
CCGAACTGCCGTCAACCAAGCCAGGAGACGCAACAGAAGGAGGTTCTTCCCGCTTAATGAGTGCAAGATCCTC---
--R--T--A--V--N--Q--A--R--R--R--N--R--R--R--F--F--P--L--N--E--C--K--I--L----

Pig Consensus Sequence

>BGISUST0000888132
ATGCTGAGTTCCATCAAATGTGTGTTGGTGGGAGACTCCGCTGTGGGGAAAACCTCCCTGTTGGTGCGCTTCACCTCCGAAACCTTCCCCGAGCACTACA
AGCCCACGGTGTACGAGAACACGGGCGTGGACGTCTTCATGGACGGCATCCAGATCAGCCTGGGCCTCTGGGACACAGCTGGCAACGACGCCTTCCGGAG
TATCCGCCCCCTGTCCTACCAGCAGGCGGACGTGGTGCTGATGTGCTACTCCGTGGCCAATTATAACTCCTTCTTGAACTTGAAGAACAAGTGGATCGGT
GAAGTCAGGAACAACCTGCCCTGCACCCCCGTGTTGGTGGTGGCCACCCAGACGGACCAGCGGGAGGTGGGGCCCCACCGGGCCTCCTGCGTCAGTGCCG
TAGAAGGCAAGAGACTGGCCCAGGACGTGAGAGCCAAGGGCTACTTGGAGTGCTCAGCCCTCAGCAACCGGGGGGTGCAGCAGGTGTTTGAGTGTGCCGT
CCGAACTGCCGTCAACCAAGCCAGGAGACGCAACAGAAGGAGGTTCTTCCCGCTTAATGAGTGCAAGATCCTC


>BGISUSP0000888132
MLSSIKCVLVGDSAVGKTSLLVRFTSETFPEHYKPTVYENTGVDVFMDGIQISLGLWDTAGNDAFRSIRPLSYQQADVVLMCYSVANYNSFLNLKNKWIG
EVRNNLPCTPVLVVATQTDQREVGPHRASCVSAVEGKRLAQDVRAKGYLECSALSNRGVQQVFECAVRTAVNQARRRNRRRFFPLNECKIL