Sequences
EST Library Info
cbr1Brain - RNA from China
cly2Lymph - RNA from China
csp4Spleen - RNA from China
cut2Uterus - RNA from China
eje1Foetus 50 days, jejunum
eru1Foetus 50 days, regio umbilicalis
eye2Foetus 50 days, Eye
fbs1Unavailable
hlv2Heart, left ventricle
jej1Small intestine, jejunum
nje1Newborn 115 days, jejunum
nmm1Newborn 115 days, mucosal membranes
Clusters
Oligos
SNPs

Gene ID ENSG00000170043 (click for geneview)
Transcript ID ENST00000303731(link to ensembl)
Symbol TRAPPC1
Localtion Chromosome:17:7774392:7775988:-1 band: 17p13.1
Description Trafficking protein particle complex subunit 1 (BET5 homolog) (Multiple myeloma protein 2) (MUM-2). [Source:Uniprot/SWISSPROT;Acc:Q9Y5R8]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-------------------------------------------------------------------------------------------------><
-M--T--V--H--N--L--Y--L--F--D--R--N--G--V--C--L--H--Y--S--E--W--H--R--K--K--Q--A--G--I--P--K--E--E--
ATGACTGTCCACAACCTGTACCTGTTTGACCGGAATGGAGTGTGTCTGCACTACAGCGAATGGCACCGCAAGAAGCAAGCAGGGATTCCCAAGGAGGAGG
::::::::::::::.:::::::::::::::::::::::::::::::::::.::::::::.::::::::::::::.:::::.:::::.:::::::::::::
ATGACTGTCCACAATCTGTACCTGTTTGACCGGAATGGAGTGTGTCTGCATTACAGCGAGTGGCACCGCAAGAAACAAGCGGGGATCCCCAAGGAGGAGG
-M--T--V--H--N--L--Y--L--F--D--R--N--G--V--C--L--H--Y--S--E--W--H--R--K--K--Q--A--G--I--P--K--E--E--

---------------------------------------------------------------------><-----------------------------
E--Y--K--L--M--Y--G--M--L--F--S--I--R--S--F--V--S--K--M--S--P--L--D--M--K--D--G--F--L--A--F--Q--T--S
AGTATAAGCTGATGTACGGGATGCTCTTCTCTATCCGCTCGTTTGTCAGCAAGATGTCCCCGCTAGACATGAAGGATGGCTTCCTGGCCTTCCAAACTAG
::::.:::::::::::::::::::::::::: :::::::: :::::::::::::::::::::::::::   :::::::::::::::::::::::.:::::
AGTACAAGCTGATGTACGGGATGCTCTTCTCAATCCGCTCCTTTGTCAGCAAGATGTCCCCGCTAGAC---AAGGATGGCTTCCTGGCCTTCCAGACTAG
E--Y--K--L--M--Y--G--M--L--F--S--I--R--S--F--V--S--K--M--S--P--L--D-----K--D--G--F--L--A--F--Q--T--S

----------------------------------------------------------------------------------------------------
--R--Y--K--L--H--Y--Y--E--T--P--T--G--I--K--V--V--M--N--T--D--L--G--V--G--P--I--R--D--V--L--H--H--I-
CCGTTACAAACTCCATTACTACGAGACGCCCACTGGGATCAAAGTTGTCATGAATACTGACTTGGGCGTGGGACCCATCCGAGATGTGCTGCACCACATC
:::::::::.:::::::::::::::::::::::::::::::::::::::::::::::::::.::::::::::::::::::::::::::::::::::::::
CCGTTACAAGCTCCATTACTACGAGACGCCCACTGGGATCAAAGTTGTCATGAATACTGACCTGGGCGTGGGACCCATCCGAGATGTGCTGCACCACATC
--R--Y--K--L--H--Y--Y--E--T--P--T--G--I--K--V--V--M--N--T--D--L--G--V--G--P--I--R--D--V--L--H--H--I-

--------><------------------------------------------------------------------------------------------
-Y--S--A--L--Y--V--E--L--V--V--K--N--P--L--C--P--L--G--Q--T--V--Q--S--E--L--F--R--S--R--L--D--S--Y--
TACAGTGCGCTGTATGTGGAGCTGGTGGTGAAGAATCCCCTGTGCCCGCTGGGCCAAACTGTGCAAAGTGAGCTCTTTCGCTCCCGACTGGACTCCTATG
::::::::::::::.::::::::::::::::::::::::::::::::..::::::::::::::::::::::::::::.:::::::: :::::::::::::
TACAGTGCGCTGTACGTGGAGCTGGTGGTGAAGAATCCCCTGTGCCCATTGGGCCAAACTGTGCAAAGTGAGCTCTTCCGCTCCCGCCTGGACTCCTATG
-Y--S--A--L--Y--V--E--L--V--V--K--N--P--L--C--P--L--G--Q--T--V--Q--S--E--L--F--R--S--R--L--D--S--Y--

------------------------------------->
V--R--S--L--P--F--F--S--A--R--A--G--*-
TTCGCTCTCTGCCCTTCTTCTCCGCCCGGGCTGGCTGA
: ::::::::::::::::::::.::::: :::::::::
TACGCTCTCTGCCCTTCTTCTCTGCCCGCGCTGGCTGA
V--R--S--L--P--F--F--S--A--R--A--G--*-

Pig Consensus Sequence

>BGISUST0000882798
ATGACTGTCCACAATCTGTACCTGTTTGACCGGAATGGAGTGTGTCTGCATTACAGCGAGTGGCACCGCAAGAAACAAGCGGGGATCCCCAAGGAGGAGG
AGTACAAGCTGATGTACGGGATGCTCTTCTCAATCCGCTCCTTTGTCAGCAAGATGTCCCCGCTAGAC---AAGGATGGCTTCCTGGCCTTCCAGACTAG
CCGTTACAAGCTCCATTACTACGAGACGCCCACTGGGATCAAAGTTGTCATGAATACTGACCTGGGCGTGGGACCCATCCGAGATGTGCTGCACCACATC
TACAGTGCGCTGTACGTGGAGCTGGTGGTGAAGAATCCCCTGTGCCCATTGGGCCAAACTGTGCAAAGTGAGCTCTTCCGCTCCCGCCTGGACTCCTATG
TACGCTCTCTGCCCTTCTTCTCTGCCCGCGCTGGCTGA


>BGISUSP0000882798
MTVHNLYLFDRNGVCLHYSEWHRKKQAGIPKEEEYKLMYGMLFSIRSFVSKMSPLD-KDGFLAFQTSRYKLHYYETPTGIKVVMNTDLGVGPIRDVLHHI
YSALYVELVVKNPLCPLGQTVQSELFRSRLDSYVRSLPFFSARAG*