Sequences
EST Library Info
cje2Jejunum - RNA from China
jca1Joint capsule
Clusters
Oligos
SNPs

Gene ID ENSG00000171729 (click for geneview)
Transcript ID ENST00000303840(link to ensembl)
Symbol TM51_HUMAN
Localtion Chromosome:1:15225535:15292178:1 band: 1p36.21
Description hypothetical protein FLJ10199
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--M--A--Q--S--K--A--N--G--S--H--Y--A--L--T--A--I--G--L--G--M--L--V--L--G--V--I--M--A--M--W--N--L--
ATGATGGCCCAGTCCAAGGCCAATGGCTCGCACTATGCGCTGACCGCCATCGGCCTGGGGATGCTGGTCCTTGGGGTGATCATGGCCATGTGGAACCTGG
   ::::::::::::::::::::::::::.::::::::::::::::::::::::::::::::::: :::::.::::: ::::::::::::::::::.:::
---ATGGCCCAGTCCAAGGCCAATGGCTCACACTATGCGCTGACCGCCATCGGCCTGGGGATGCTTGTCCTCGGGGTCATCATGGCCATGTGGAACTTGG
----M--A--Q--S--K--A--N--G--S--H--Y--A--L--T--A--I--G--L--G--M--L--V--L--G--V--I--M--A--M--W--N--L--

----------------------------------------------------------------------------------------------------
V--P--G--F--S--A--A--E--K--P--T--A--Q--G--S--N--K--T--E--V--G--G--G--I--L--K--S--K--T--F--S--V--A--Y
TACCCGGCTTCAGCGCGGCCGAGAAGCCAACAGCTCAGGGCAGCAACAAGACCGAGGTGGGTGGCGGCATCCTCAAGAGCAAGACCTTCTCTGTGGCCTA
: ::::: :::::.::  :.::.:::::.:: :::::::: :.:::.::::: ::..: :: .::.:::::::::::::::::::::::::.::::::::
TCCCCGGGTTCAGTGCTTCTGAAAAGCCGACCGCTCAGGGGAACAATAAGACAGAAATCGGGAGCAGCATCCTCAAGAGCAAGACCTTCTCCGTGGCCTA
V--P--G--F--S--A--S--E--K--P--T--A--Q--G--N--N--K--T--E--I--G--S--S--I--L--K--S--K--T--F--S--V--A--Y

----------------------------------------------------------------------------------------------------
--V--L--V--G--A--G--V--M--L--L--L--L--S--I--C--L--S--I--R--D--K--R--K--Q--R--Q--G--E--D--L--A--H--V-
CGTGCTGGTCGGGGCCGGGGTGATGCTGCTGCTGCTTTCTATCTGCCTGAGTATCAGGGATAAGAGGAAGCAGCGGCAGGGCGAGGACCTGGCCCATGTC
::::::::: :: ::.::::::::::: :::::::: ::.:::::::::::.::: ::::.:::::::::::::::::.:::::::: ::::: ::..::
CGTGCTGGTGGGCGCTGGGGTGATGCTCCTGCTGCTGTCCATCTGCCTGAGCATCCGGGACAAGAGGAAGCAGCGGCAAGGCGAGGAGCTGGCGCACATC
--V--L--V--G--A--G--V--M--L--L--L--L--S--I--C--L--S--I--R--D--K--R--K--Q--R--Q--G--E--E--L--A--H--I-

-------------------------------------------><-------------------------------------------------------
-Q--H--P--T--G--A--G--P--H--A--Q--E--E--D--S--Q--E--E--E--E--E--D--E--E--A--A--S--R--Y--Y--V--P--S--
CAGCACCCGACAGGCGCTGGGCCTCACGCCCAGGAGGAAGACAGCCAGGAGGAAGAAGAGGAGGATGAGGAGGCTGCCTCAAGGTACTATGTTCCCAGCT
::::: :::   :: :..:.::::::::::::::::::::::    :.:: ..  :.::.::::: ::::::::. :.::::::::::::::.:::::::
CAGCAGCCG---GGGGTCGAGCCTCACGCCCAGGAGGAAGAC---GAAGACAGCCAGGAAGAGGAGGAGGAGGCCTCTTCAAGGTACTATGTCCCCAGCT
-Q--Q--P-----G--V--E--P--H--A--Q--E--E--D-----E--D--S--Q--E--E--E--E--E--A--S--S--R--Y--Y--V--P--S--

----------------------------------------------------------------------------------------------------
Y--E--E--V--M--N--T--N--Y--S--E--A--R--G--E--E--Q--N--P--R--L--S--I--S--L--P--S--Y--E--S--L--T--G--L
ACGAGGAAGTGATGAACACAAACTACTCAGAAGCAAGGGGAGAGGAGCAGAACCCGAGGTTGAGCATCTCTCTCCCGTCCTATGAGTCACTGACGGGGCT
:::::::::::::::::::.::.:::::.:::::.::::.:  .:: :::::::: ::: :::::::.:::::::: ::::::::::: :::::::::::
ACGAGGAAGTGATGAACACGAATTACTCGGAAGCGAGGGAACCAGACCAGAACCCCAGGATGAGCATTTCTCTCCCCTCCTATGAGTCTCTGACGGGGCT
Y--E--E--V--M--N--T--N--Y--S--E--A--R--E--P--D--Q--N--P--R--M--S--I--S--L--P--S--Y--E--S--L--T--G--L

----------------------------------------------------------------------------------------------------
--D--E--T--T--P--T--S--T--R--A--D--V--E--A--S--P--G--N--P--P--D--R--Q--N--S--K--L--A--K--R--L--K--P-
CGACGAGACCACCCCCACATCCACCAGGGCTGACGTGGAGGCCAGCCCTGGGAACCCCCCTGACAGGCAGAACTCTAAGTTGGCCAAACGACTGAAACCG
 :::::::: : ::::::  : ::.:::::.:::.:.:::.::::::: :::::::::::.::::::::::::::.:::.:::::::::: :::::.:::
GGACGAGACGAGCCCCACCACAACTAGGGCCGACATAGAGACCAGCCCAGGGAACCCCCCCGACAGGCAGAACTCCAAGCTGGCCAAACGCCTGAAGCCG
--D--E--T--S--P--T--T--T--R--A--D--I--E--T--S--P--G--N--P--P--D--R--Q--N--S--K--L--A--K--R--L--K--P-

----------------------------------------------------------------------------------------------------
-L--K--V--R--R--I--K--S--E--K--L--H--L--K--D--F--R--I--N--L--P--D--K--N--V--P--P--P--S--I--E--P--L--
CTGAAAGTTCGAAGGATTAAATCTGAAAAGCTTCACCTCAAAGACTTTAGGATCAACCTCCCAGACAAAAACGTCCCTCCTCCCTCGATAGAGCCTTTGA
::::::::::::::::: :::::.:::::::: :::::::::::::::::::::::::: :::::::::::.:: :::::.:: :: :: ::::::::::
CTGAAAGTTCGAAGGATAAAATCCGAAAAGCTGCACCTCAAAGACTTTAGGATCAACCTGCCAGACAAAAATGTGCCTCCCCCATCCATCGAGCCTTTGA
-L--K--V--R--R--I--K--S--E--K--L--H--L--K--D--F--R--I--N--L--P--D--K--N--V--P--P--P--S--I--E--P--L--

------------------------------------------------------------->
T--P--P--P--Q--Y--D--E--V--Q--E--K--A--P--D--T--R--P--P--D--*-
CTCCTCCACCGCAGTATGATGAAGTCCAGGAGAAGGCCCCCGACACCCGGCCGCCCGACTGA
::::.:: ::.:::::.:: ::.::::::::::::::::::::..::::::: :::::::::
CTCCCCCTCCACAGTACGAGGAGGTCCAGGAGAAGGCCCCCGATGCCCGGCCTCCCGACTGA
T--P--P--P--Q--Y--E--E--V--Q--E--K--A--P--D--A--R--P--P--D--*-

Pig Consensus Sequence

>BGISUST0000901193
---ATGGCCCAGTCCAAGGCCAATGGCTCACACTATGCGCTGACCGCCATCGGCCTGGGGATGCTTGTCCTCGGGGTCATCATGGCCATGTGGAACTTGG
TCCCCGGGTTCAGTGCTTCTGAAAAGCCGACCGCTCAGGGGAACAATAAGACAGAAATCGGGAGCAGCATCCTCAAGAGCAAGACCTTCTCCGTGGCCTA
CGTGCTGGTGGGCGCTGGGGTGATGCTCCTGCTGCTGTCCATCTGCCTGAGCATCCGGGACAAGAGGAAGCAGCGGCAAGGCGAGGAGCTGGCGCACATC
CAGCAGCCGGGGGTCGAGCCTCACGCCCAGGAGGAAGAC---GAAGACAGCCAGGAAGAGGAGGAGGAGGCCTCTTCAAGGTACTATGTCCCCAGCTACG
AGGAAGTGATGAACACGAATTACTCGGAAGCGAGGGAACCAGACCAGAACCCCAGGATGAGCATTTCTCTCCCCTCCTATGAGTCTCTGACGGGGCTGGA
CGAGACGAGCCCCACCACAACTAGGGCCGACATAGAGACCAGCCCAGGGAACCCCCCCGACAGGCAGAACTCCAAGCTGGCCAAACGCCTGAAGCCGCTG
AAAGTTCGAAGGATAAAATCCGAAAAGCTGCACCTCAAAGACTTTAGGATCAACCTGCCAGACAAAAATGTGCCTCCCCCATCCATCGAGCCTTTGACTC
CCCCTCCACAGTACGAGGAGGTCCAGGAGAAGGCCCCCGATGCCCGGCCTCCCGACTGA


>BGISUSP0000901193
-MAQSKANGSHYALTAIGLGMLVLGVIMAMWNLVPGFSASEKPTAQGNNKTEIGSSILKSKTFSVAYVLVGAGVMLLLLSICLSIRDKRKQRQGEELAHI
QQPGVEPHAQEED-EDSQEEEEEASSRYYVPSYEEVMNTNYSEAREPDQNPRMSISLPSYESLTGLDETSPTTTRADIETSPGNPPDRQNSKLAKRLKPL
KVRRIKSEKLHLKDFRINLPDKNVPPPSIEPLTPPPQYEEVQEKAPDARPPD*