Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000170961 (click for geneview)
Transcript ID ENST00000303924(link to ensembl)
Symbol HAS2
Localtion Chromosome:8:122694719:122722811:-1 band: 8q24.13
Description Hyaluronan synthase 2 (EC 2.4.1.212) (Hyaluronate synthase 2) (Hyaluronic acid synthase 2) (HA synthase 2). [Source:Uniprot/SWISSPROT;Acc:Q92819]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--H--C--E--R--F--L--C--I--L--R--I--I--G--T--T--L--F--G--V--S--L--L--L--G--I--T--A--A--Y--I--V--G--
ATGCATTGTGAGAGGTTTCTATGTATCCTGAGAATAATTGGAACCACACTCTTTGGAGTCTCTCTCCTCCTTGGAATCACAGCTGCTTATATTGTTGGCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
Y--Q--F--I--Q--T--D--N--Y--Y--F--S--F--G--L--Y--G--A--F--L--A--S--H--L--I--I--Q--S--L--F--A--F--L--E
ACCAGTTTATCCAAACGGATAATTACTATTTCTCTTTTGGACTGTATGGTGCCTTTTTGGCATCACACCTCATCATCCAAAGCCTGTTTGCCTTTTTGGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--H--R--K--M--K--K--S--L--E--T--P--I--K--L--N--K--T--V--A--L--C--I--A--A--Y--Q--E--D--P--D--Y--L--R-
GCACCGAAAAATGAAAAAATCCCTAGAAACCCCCATAAAGTTGAACAAAACAGTTGCCCTTTGCATCGCTGCCTATCAAGAAGATCCAGACTACTTAAGG
 ::.:.:::::::::::::: :.::.: :.:::::: :: :::::: : :: .::::.::::::::::: ::::::::::::::::::.:::::::. :.
-CATCAAAAAATGAAAAAATACTTAAATATCCCCATTAACTTGAACCACACTATTGCTCTTTGCATCGCGGCCTATCAAGAAGATCCAAACTACTTGCGA
--H--Q--K--M--K--K--Y--L--N--I--P--I--N--L--N--H--T--I--A--L--C--I--A--A--Y--Q--E--D--P--N--Y--L--R-

----------------------------------------------------------------------------------------------------
-K--C--L--Q--S--V--K--R--L--T--Y--P--G--I--K--V--V--M--V--I--D--G--N--S--E--D--D--L--Y--M--M--D--I--
AAATGTTTGCAATCTGTGAAAAGGCTAACCTACCCTGGGATTAAAGTTGTCATGGTCATAGATGGGAACTCAGAAGATGACCTTTACATGATGGACATCT
::.:::::::::::::::::::::::::::::::::::.:::::::: :::::::::::::::::::::::.::::::::::::::::::::::::::::
AAGTGTTTGCAATCTGTGAAAAGGCTAACCTACCCTGGAATTAAAGTGGTCATGGTCATAGATGGGAACTCGGAAGATGACCTTTACATGATGGACATCT
-K--C--L--Q--S--V--K--R--L--T--Y--P--G--I--K--V--V--M--V--I--D--G--N--S--E--D--D--L--Y--M--M--D--I--

----------------------------------------------------------------------------------------------------
F--S--E--V--M--G--R--D--K--S--A--T--Y--I--W--K--N--N--F--H--E--K--G--P--G--E--T--D--E--S--H--K--E--S
TCAGTGAAGTCATGGGCAGAGACAAATCAGCCACTTATATCTGGAAGAACAACTTCCACGAAAAGGGTCCCGGTGAGACAGATGAGTCACATAAAGAAAG
:::::::::::::::::::..:::: :::::::::::::::::::::::::::::::::::.::.:::::.::::::::.: :::::::::::.:::: :
TCAGTGAAGTCATGGGCAGGAACAATTCAGCCACTTATATCTGGAAGAACAACTTCCACGAGAAAGGTCCTGGTGAGACGGTTGAGTCACATAGAGAACG
F--S--E--V--M--G--R--N--N--S--A--T--Y--I--W--K--N--N--F--H--E--K--G--P--G--E--T--V--E--S--H--R--E--R

----------------------------------------------------------------------------------------------------
--S--Q--H--V--T--Q--L--V--L--S--N--K--S--I--C--I--M--Q--K--W--G--G--K--R--E--V--M--Y--T--A--F--R--A-
CTCGCAACACGTAACGCAATTGGTCTTGTCCAACAAAAGTATCTGCATCATGCAAAAATGGGGTGGAAAAAGAGAAGTCATGTACACAGCCTTCAGAGCA
::: :.:::.:: :: :::.:::::::::::::::::: :.:.::::::::::::::::::::::::                                 
CTCCCGACATGTCACCCAACTGGTCTTGTCCAACAAAACTGTTTGCATCATGCAAAAATGGGGTGGA---------------------------------
--S--R--H--V--T--Q--L--V--L--S--N--K--T--V--C--I--M--Q--K--W--G--G----------------------------------

--------------------------><------------------------------------------------------------------------
-L--G--R--S--V--D--Y--V--Q--V--C--D--S--D--T--M--L--D--P--A--S--S--V--E--M--V--K--V--L--E--E--D--P--
CTGGGACGAAGTGTGGATTATGTACAGGTTTGTGATTCAGACACTATGCTTGACCCAGCCTCATCTGTGGAGATGGTAAAAGTTTTAGAAGAAGATCCCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------><----------------------------------------------------------------------
M--V--G--G--V--G--G--D--V--Q--I--L--N--K--Y--D--S--W--I--S--F--L--S--S--V--R--Y--W--M--A--F--N--I--E
TGGTTGGAGGTGTTGGGGGAGATGTCCAGATTTTAAACAAGTACGATTCCTGGATCTCATTCCTCAGCAGTGTAAGATATTGGATGGCTTTTAATATAGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--R--A--C--Q--S--Y--F--G--C--V--Q--C--I--S--G--P--L--G--M--Y--R--N--S--L--L--H--E--F--V--E--D--W--Y-
AAGGGCCTGTCAGTCTTATTTTGGGTGTGTTCAGTGCATTAGTGGACCTCTGGGAATGTACAGAAACTCCTTGTTGCATGAGTTTGTGGAAGATTGGTAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-N--Q--E--F--M--G--N--Q--C--S--F--G--D--D--R--H--L--T--N--R--V--L--S--L--G--Y--A--T--K--Y--T--A--R--
AATCAAGAATTTATGGGCAACCAATGTAGCTTTGGTGATGACAGGCATCTCACGAACCGGGTGCTGAGCCTGGGCTATGCAACAAAATACACAGCTCGAT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
S--K--C--L--T--E--T--P--I--E--Y--L--R--W--L--N--Q--Q--T--R--W--S--K--S--Y--F--R--E--W--L--Y--N--A--M
CTAAGTGCCTTACTGAAACACCTATAGAATATCTCAGATGGCTAAACCAGCAGACCCGTTGGAGCAAGTCCTACTTCCGAGAATGGCTGTACAATGCAAT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--W--F--H--K--H--H--L--W--M--T--Y--E--A--I--I--T--G--F--F--P--F--F--L--I--A--T--V--I--Q--L--F--Y--R-
GTGGTTTCACAAACATCACTTGTGGATGACCTACGAAGCGATTATCACTGGATTCTTTCCTTTCTTTCTCATTGCCACAGTAATCCAGCTCTTCTACCGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-G--K--I--W--N--I--L--L--F--L--L--T--V--Q--L--V--G--L--I--K--S--S--F--A--S--C--L--R--G--N--I--V--M--
GGTAAAATTTGGAACATTCTCCTCTTCTTGTTAACTGTCCAGCTAGTAGGTCTCATAAAATCATCTTTTGCCAGCTGCCTTAGAGGAAATATCGTCATGG
                                                                                 ::::::::.:::::::::.
---------------------------------------------------------------------------------AGAGGAAACATCGTCATGA
----------------------------------------------------------------------------------R--G--N--I--V--M--

----------------------------------------------------------------------------------------------------
V--F--M--S--L--Y--S--V--L--Y--M--S--S--L--L--P--A--K--M--F--A--I--A--T--I--N--K--A--G--W--G--T--S--G
TCTTCATGTCTCTCTACTCAGTGTTATACATGTCGAGTTTACTTCCCGCCAAGATGTTTGCAATTGCAACAATAAACAAAGCTGGGTGGGGCACATCAGG
::::::::::..::::::: :::::.:::::::: :::::::::::.::::::::.::::: ::::::::::::::::.:::::: ::::::::::: ::
TCTTCATGTCCTTCTACTCCGTGTTGTACATGTCCAGTTTACTTCCTGCCAAGATATTTGCCATTGCAACAATAAACAGAGCTGGCTGGGGCACATCTGG
I--F--M--S--F--Y--S--V--L--Y--M--S--S--L--L--P--A--K--I--F--A--I--A--T--I--N--R--A--G--W--G--T--S--G

----------------------------------------------------------------------------------------------------
--R--K--T--I--V--V--N--F--I--G--L--I--P--V--S--V--W--F--T--I--L--L--G--G--V--I--F--T--I--Y--K--E--S-
AAGGAAAACCATTGTTGTTAATTTCATAGGACTCATTCCAGTATCAGTTTGGTTTACAATCCTCCTGGGTGGTGTGATTTTCACCATTTATAAGGAGTCT
:::::::::::::::::.:::::::::.::::::::::::::.::..:::::.:::::::::::::::::::: :.:::::::::::::::.::::.:: 
AAGGAAAACCATTGTTGCTAATTTCATGGGACTCATTCCAGTGTCGATTTGGCTTACAATCCTCCTGGGTGGTTTAATTTTCACCATTTATGAGGAATCA
--R--K--T--I--V--A--N--F--M--G--L--I--P--V--S--I--W--L--T--I--L--L--G--G--L--I--F--T--I--Y--E--E--S-

----------------------------------------------------------------------------------------------------
-K--R--P--F--S--E--S--K--Q--T--V--L--I--V--G--T--L--L--Y--A--C--Y--W--V--M--L--L--T--L--Y--V--V--L--
AAAAGGCCATTTTCAGAATCCAAACAGACAGTTCTAATTGTTGGAACGTTGCTCTATGCATGCTATTGGGTCATGCTTTTGACGCTGTATGTAGTTCTCA
::::.::::::.::::::. ::::  :: :::: ::: :.:::::... .  ::::::.::::::::::.:..::.:::: :.:::::::::. ::.:.:
AAAAAGCCATTCTCAGAACACAAAATGAAAGTTATAAGTATTGGAGTAGCTGTCTATGTATGCTATTGGATTGTGTTTTTCATGCTGTATGTGCTTTTTA
-K--K--P--F--S--E--H--K--M--K--V--I--S--I--G--V--A--V--Y--V--C--Y--W--I--V--F--F--M--L--Y--V--L--F--

---------------------------------------------------------->
I--N--K--C--G--R--R--K--K--G--Q--Q--Y--D--M--V--L--D--V--*-
TCAATAAGTGTGGCAGGCGGAAGAAGGGACAACAATATGACATGGTGCTTGATGTATGA
:::::::.:::::.:::::.::::::..::::::.::.::::::.::::::::::::.:
TCAATAAATGTGGTAGGCGAAAGAAGAAACAACAGTACGACATGATGCTTGATGTATAA
I--N--K--C--G--R--R--K--K--K--Q--Q--Y--D--M--M--L--D--V--*-

Pig Consensus Sequence

>BGISUST0000883748
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-CATCAAAAAATGAAAAAATACTTAAATATCCCCATTAACTTGAACCACACTATTGCTCTTTGCATCGCGGCCTATCAAGAAGATCCAAACTACTTGCGA
AAGTGTTTGCAATCTGTGAAAAGGCTAACCTACCCTGGAATTAAAGTGGTCATGGTCATAGATGGGAACTCGGAAGATGACCTTTACATGATGGACATCT
TCAGTGAAGTCATGGGCAGGAACAATTCAGCCACTTATATCTGGAAGAACAACTTCCACGAGAAAGGTCCTGGTGAGACGGTTGAGTCACATAGAGAACG
CTCCCGACATGTCACCCAACTGGTCTTGTCCAACAAAACTGTTTGCATCATGCAAAAATGGGGTGGA---------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
---------------------------------------------------------------------------------AGAGGAAACATCGTCATGA
TCTTCATGTCCTTCTACTCCGTGTTGTACATGTCCAGTTTACTTCCTGCCAAGATATTTGCCATTGCAACAATAAACAGAGCTGGCTGGGGCACATCTGG
AAGGAAAACCATTGTTGCTAATTTCATGGGACTCATTCCAGTGTCGATTTGGCTTACAATCCTCCTGGGTGGTTTAATTTTCACCATTTATGAGGAATCA
AAAAAGCCATTCTCAGAACACAAAATGAAAGTTATAAGTATTGGAGTAGCTGTCTATGTATGCTATTGGATTGTGTTTTTCATGCTGTATGTGCTTTTTA
TCAATAAATGTGGTAGGCGAAAGAAGAAACAACAGTACGACATGATGCTTGATGTATAA


>BGISUSP0000883748
-------------------------------------------------------------------HQKMKKYLNIPINLNHTIALCIAAYQEDPNYLR
KCLQSVKRLTYPGIKVVMVIDGNSEDDLYMMDIFSEVMGRNNSATYIWKNNFHEKGPGETVESHRERSRHVTQLVLSNKTVCIMQKWGG-----------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
---------------------------RGNIVMIFMSFYSVLYMSSLLPAKIFAIATINRAGWGTSGRKTIVANFMGLIPVSIWLTILLGGLIFTIYEES
KKPFSEHKMKVISIGVAVYVCYWIVFFMLYVLFINKCGRRKKKQQYDMMLDV*