Sequences
EST Library Info
thg1Thyroid gland
Clusters
Oligos
SNPs

Gene ID ENSG00000047365 (click for geneview)
Transcript ID ENST00000303965(link to ensembl)
Symbol CENTD1
Localtion Chromosome:4:35890188:36068545:-1 band: 4p14
Description centaurin delta 1 isoform a [Source:RefSeq_peptide;Acc:NP_056045]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--S--S--V--S--E--V--N--V--D--I--K--D--F--L--M--S--I--N--L--E--Q--Y--L--L--H--F--H--E--S--G--F--T--
ATGTCCTCAGTCAGTGAAGTAAATGTGGATATAAAAGATTTCCTAATGAGCATTAATTTGGAGCAGTATCTCTTACATTTCCATGAGTCTGGTTTTACTA
:::::::::::::::::::::::::::::::: :::::::::::::::::::::::::::::::::::.:::.:::..::::..::::.:::::::: ::
ATGTCCTCAGTCAGTGAAGTAAATGTGGATATCAAAGATTTCCTAATGAGCATTAATTTGGAGCAGTACCTCCTACGCTTCCGCGAGTTTGGTTTTAATA
-M--S--S--V--S--E--V--N--V--D--I--K--D--F--L--M--S--I--N--L--E--Q--Y--L--L--R--F--R--E--F--G--F--N--

----------------------------------------------------------------------------------------------------
T--V--K--D--C--A--A--I--N--D--S--L--L--Q--K--I--G--I--S--P--T--G--H--R--R--R--I--L--K--Q--L--Q--I--I
CTGTGAAGGACTGTGCAGCAATAAATGACAGCCTGCTGCAGAAAATTGGAATATCACCTACAGGTCACCGTAGGAGGATACTTAAACAGTTACAGATAAT
 ::::: ::::::..::: .:::::::::::: ::::::  :::.::::::::::::::::.:: ::: : :::::::::::::::::::::::::::::
ATGTGATGGACTGCACAGGGATAAATGACAGCGTGCTGCTCAAAGTTGGAATATCACCTACGGGACACAGGAGGAGGATACTTAAACAGTTACAGATAAT
N--V--M--D--C--T--G--I--N--D--S--V--L--L--K--V--G--I--S--P--T--G--H--R--R--R--I--L--K--Q--L--Q--I--I

----------------------------------------------------------------------------------------------------
--L--S--K--M--Q--D--I--P--I--Y--A--N--V--H--K--T--K--K--N--D--D--P--S--K--D--Y--H--V--P--S--S--D--Q-
CTTGTCAAAAATGCAAGATATTCCAATATATGCAAATGTTCATAAAACTAAGAAGAATGATGACCCTTCAAAGGATTACCATGTTCCATCTTCTGATCAG
:::::::::::::::::::::.:::.: ::::::::::::::.:::.: :::::::.::::::  :.:::.: :::.::::::.:::..:::::::::::
CTTGTCAAAAATGCAAGATATCCCAGTCTATGCAAATGTTCACAAAGCAAAGAAGAGTGATGAGACCTCAGACGATCACCATGCTCCGCCTTCTGATCAG
--L--S--K--M--Q--D--I--P--V--Y--A--N--V--H--K--A--K--K--S--D--E--T--S--D--D--H--H--A--P--P--S--D--Q-

----------------------------------------------------------------------------------------------------
-N--I--C--I--E--L--S--N--S--G--S--V--Q--T--S--S--P--P--Q--L--E--T--V--R--K--N--L--E--D--S--D--A--S--
AATATCTGCATAGAACTTTCCAATTCTGGTAGTGTTCAGACATCTAGCCCACCGCAGTTGGAGACTGTTAGAAAAAATCTTGAAGACAGTGATGCAAGTG
::.  ::::                                                                                           
AACCACTGC-------------------------------------------------------------------------------------------
-N--H--C--------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
V--E--R--S--Q--Y--P--Q--S--D--D--K--L--S--P--P--K--R--D--F--P--T--A--E--E--P--H--L--N--L--G--S--L--N
TGGAAAGAAGCCAGTATCCTCAATCAGATGATAAGCTGTCTCCTCCTAAACGCGACTTCCCCACTGCAGAGGAACCACACCTGAATTTGGGTTCTTTGAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--D--S--L--F--G--S--D--N--I--K--I--E--S--L--I--T--K--K--T--V--D--H--T--V--E--E--Q--Q--T--E--K--V--K-
TGATTCTTTATTTGGTAGTGACAATATTAAAATAGAATCATTGATTACAAAGAAGACTGTGGATCACACAGTTGAAGAACAACAAACAGAAAAAGTTAAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-L--I--T--E--N--L--S--K--L--P--N--A--D--S--E--C--L--S--F--V--G--C--S--T--S--G--T--N--S--G--N--G--T--
TTGATCACAGAAAATCTCAGTAAGCTCCCTAATGCAGACTCTGAATGCCTTTCTTTTGTTGGCTGTTCAACATCAGGAACAAATTCTGGAAATGGAACAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
N--G--L--L--E--G--S--P--P--S--P--F--F--K--F--Q--G--E--M--I--V--N--D--L--Y--V--P--S--S--P--I--L--A--P
ATGGTTTATTAGAAGGATCACCACCATCCCCATTCTTTAAGTTTCAAGGAGAAATGATTGTAAATGACTTGTATGTTCCATCATCACCAATCCTAGCACC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--V--R--S--R--S--K--L--V--S--R--P--S--R--S--F--L--L--R--H--R--P--V--P--E--I--P--G--S--T--K--G--V--S-
TGTGAGAAGTCGTAGCAAGTTGGTTTCAAGACCATCTCGATCTTTTCTGCTAAGACATCGACCTGTACCAGAGATTCCAGGGTCAACAAAAGGAGTTTCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----><---------------------------------------------------------><-----------------------------------
-G--S--Y--F--R--E--R--R--N--V--A--T--S--T--E--K--S--V--A--W--Q--N--S--N--E--E--N--S--S--S--I--F--P--
GGGAGCTATTTCCGTGAAAGAAGAAATGTTGCTACCTCAACTGAAAAATCTGTGGCATGGCAAAATTCAAATGAGGAGAATTCATCTTCCATCTTTCCTT
                                                                  ::::::::::::::::::::::::::.:: ::.:
------------------------------------------------------------------TCAAATGAGGAGAATTCATCTTCCATTTTACCCT
-------------------------------------------------------------------S--N--E--E--N--S--S--S--I--L--P--

----------------------------------------><----------------------------------------------------------
Y--G--E--T--F--L--F--Q--R--L--E--N--S--K--K--R--S--I--K--N--E--F--L--T--Q--G--E--A--L--K--G--E--A--A
ATGGAGAGACCTTTCTCTTCCAGAGACTAGAAAATTCCAAGAAGCGATCTATAAAGAATGAATTTTTGACCCAGGGAGAAGCACTCAAAGGGGAAGCAGC
::::::::::::::::::::::::.::::::::::::.:::                                                           
ATGGAGAGACCTTTCTCTTCCAGAAACTAGAAAATTCTAAG-----------------------------------------------------------
Y--G--E--T--F--L--F--Q--K--L--E--N--S--K------------------------------------------------------------

--------------------------------><------------------------------------------------------------------
--T--A--T--N--S--F--I--I--K--S--S--I--Y--D--N--R--K--E--K--I--S--E--D--K--V--E--D--I--W--I--P--R--E-
TACTGCAACAAACTCTTTTATCATCAAATCAAGCATATACGATAACAGAAAGGAGAAAATAAGCGAGGACAAGGTGGAAGATATTTGGATACCTCGAGAG
                                  :::::.::::::::.: .::::: :::: .::.:::::::::::::::::::::::::::::: ::
----------------------------------ATATATGATAACAGGACAGAGAATATAACTGAAGACAAGGTGGAAGATATTTGGATACCTCGACAG
-----------------------------------I--Y--D--N--R--T--E--N--I--T--E--D--K--V--E--D--I--W--I--P--R--Q-

----------------------------------------------------------------------------------------------------
-D--K--N--N--F--L--I--D--T--A--S--E--S--E--Y--S--T--V--E--E--C--F--Q--S--L--R--R--K--N--S--K--A--S--
GACAAAAACAATTTTTTGATAGACACTGCTTCTGAATCAGAATACTCAACAGTAGAAGAATGCTTTCAGAGTTTAAGAAGAAAAAATTCAAAGGCATCTA
::::::::::::.::.. :::::: ::::::: :::::::::::.:::::::::::::::::.:::::::::::::::::::::::::::::: ::::::
GACAAAAACAATCTTCCTATAGACTCTGCTTCAGAATCAGAATATTCAACAGTAGAAGAATGTTTTCAGAGTTTAAGAAGAAAAAATTCAAAGCCATCTA
-D--K--N--N--L--P--I--D--S--A--S--E--S--E--Y--S--T--V--E--E--C--F--Q--S--L--R--R--K--N--S--K--P--S--

----------------------------------------------------------------------------------------------------
K--S--R--T--Q--K--A--L--I--L--D--S--V--N--R--H--S--Y--P--L--S--S--T--S--G--N--A--D--S--S--A--V--S--S
AATCTAGGACTCAAAAAGCCTTGATTTTGGACTCCGTTAATAGGCACAGTTATCCGTTAAGCTCAACAAGTGGAAATGCTGATTCATCAGCCGTTTCTTC
::::: ::::.:::::::: :::: :::::::.:.::::::::::::::::::::..::::.:::::::::::::::::::::::::: ..:.:::::::
AATCTCGGACCCAAAAAGCATTGAATTTGGACCCTGTTAATAGGCACAGTTATCCACTAAGTTCAACAAGTGGAAATGCTGATTCATCCATCATTTCTTC
K--S--R--T--Q--K--A--L--N--L--D--P--V--N--R--H--S--Y--P--L--S--S--T--S--G--N--A--D--S--S--I--I--S--S

--------------------------------------------------------------------------------------><------------
--Q--A--I--S--P--Y--A--C--F--Y--G--A--S--A--K--K--V--K--S--G--W--L--D--K--L--S--P--Q--G--K--R--M--F-
ACAGGCAATATCTCCCTATGCCTGCTTTTATGGAGCATCTGCAAAGAAGGTTAAATCAGGATGGCTGGATAAACTCTCTCCTCAAGGAAAACGCATGTTT
: : :.:::::::::.::::::::.::::::::: : ::::.::::::::::::::: ::::::::.::.::::::: :::.:::               
AAATGTAATATCTCCTTATGCCTGTTTTTATGGATCTTCTGTAAAGAAGGTTAAATCTGGATGGCTAGACAAACTCTGTCCCCAA---------------
--N--V--I--S--P--Y--A--C--F--Y--G--S--S--V--K--K--V--K--S--G--W--L--D--K--L--C--P--Q----------------

--------------------------------------------------------><------------------------------------------
-Q--K--R--W--V--K--F--D--G--L--S--I--S--Y--Y--N--N--E--K--E--M--Y--S--K--G--I--I--P--L--S--A--I--S--
CAAAAGAGATGGGTGAAATTTGATGGCCTTAGCATTTCTTACTACAATAATGAGAAGGAGATGTATTCGAAAGGAATAATTCCCCTTTCTGCTATATCAA
                                                         :::: ::::::.::::::::::::::::::::::::::::: :
---------------------------------------------------------GAGAAGTATTCAAAAGGAATAATTCCCCTTTCTGCTATATCTA
----------------------------------------------------------E--K--Y--S--K--G--I--I--P--L--S--A--I--S--

-----------------------------------------------------------------------------><---------------------
T--V--R--V--Q--G--D--N--K--F--E--V--V--T--T--Q--R--T--F--V--F--R--V--E--K--E--E--E--R--N--D--W--I--S
CAGTACGAGTTCAAGGAGACAACAAATTTGAAGTTGTTACAACACAAAGAACTTTTGTTTTTAGAGTAGAAAAAGAAGAGGAGAGAAATGACTGGATCAG
::::::::::::::::::::::::::::::::::::::::::::::.::::::::::::::::::::::::::::::   ::::::::::::::::::::
CAGTACGAGTTCAAGGAGACAACAAATTTGAAGTTGTTACAACACAGAGAACTTTTGTTTTTAGAGTAGAAAAAGAA---GAGAGAAATGACTGGATCAG
T--V--R--V--Q--G--D--N--K--F--E--V--V--T--T--Q--R--T--F--V--F--R--V--E--K--E-----E--R--N--D--W--I--S

----------------------------------------------------------------------------------------------------
--I--L--L--N--A--L--K--S--Q--S--L--T--S--Q--S--Q--A--V--V--T--P--E--K--C--G--Y--L--E--L--R--G--Y--K-
CATACTATTAAATGCACTGAAATCACAATCCCTTACCTCGCAGTCTCAAGCTGTTGTTACACCTGAGAAATGTGGATATCTTGAATTGAGAGGCTATAAG
::::::.::::::::::::::::.:::. ::::: ::::.::::::::::: :.::::.::::::::::::::::::::::::::.:::::::.:::::.
CATACTGTTAAATGCACTGAAATTACAGGCCCTTTCCTCACAGTCTCAAGCAGCTGTTGCACCTGAGAAATGTGGATATCTTGAACTGAGAGGTTATAAA
--I--L--L--N--A--L--K--L--Q--A--L--S--S--Q--S--Q--A--A--V--A--P--E--K--C--G--Y--L--E--L--R--G--Y--K-

--------------------------------------------------------><------------------------------------------
-A--K--I--F--T--V--L--S--G--N--S--V--W--L--C--K--N--E--Q--D--F--K--S--G--L--G--I--T--I--I--P--M--N--
GCAAAAATTTTTACTGTGTTAAGTGGAAACAGTGTGTGGCTTTGCAAAAACGAACAGGATTTTAAGAGTGGACTTGGTATTACCATAATTCCTATGAATG
:: :::::::::::::::::::::::.::::::::::::::.::::::::.::::::                                           
GCCAAAATTTTTACTGTGTTAAGTGGGAACAGTGTGTGGCTCTGCAAAAATGAACAG-------------------------------------------
-A--K--I--F--T--V--L--S--G--N--S--V--W--L--C--K--N--E--Q--------------------------------------------

------------------------------------------------------------------------><--------------------------
V--A--N--V--K--Q--V--D--R--T--V--K--Q--S--F--E--I--I--T--P--Y--R--S--F--S--F--T--A--E--T--E--K--E--K
TAGCAAATGTAAAGCAAGTGGACCGAACTGTGAAACAATCTTTTGAAATAATCACTCCCTACAGGAGTTTCAGCTTTACAGCCGAGACTGAAAAGGAGAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--Q--D--W--I--E--A--V--Q--Q--S--I--A--E--T--L--S--D--Y--E--V--A--E--K--I--W--F--N--E--S--N--R--S--C-
ACAAGACTGGATTGAAGCTGTGCAGCAATCAATAGCAGAAACTCTCTCTGATTATGAAGTAGCTGAGAAGATTTGGTTCAATGAATCCAACAGGAGCTGT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------------------------------------------------------------------><--------------------------
-A--D--C--K--A--P--D--P--D--W--A--S--I--N--L--C--V--V--I--C--K--K--C--A--G--Q--H--R--S--L--G--P--K--
GCAGATTGTAAAGCCCCAGATCCTGACTGGGCATCCATCAATCTCTGTGTTGTCATCTGTAAGAAGTGTGCAGGACAGCATAGATCTTTAGGACCAAAAG
                                                                           ::.::::::::::::::::::::::
---------------------------------------------------------------------------CAACATAGATCTTTAGGACCAAAAG
----------------------------------------------------------------------------Q--H--R--S--L--G--P--K--

----------------------------------------------------------><----------------------------------------
D--S--K--V--R--S--L--K--M--D--A--S--I--W--S--N--E--L--I--E--L--F--I--V--I--G--N--K--R--A--N--D--F--W
ATTCCAAGGTTAGAAGTCTAAAAATGGATGCTAGCATTTGGAGCAATGAACTCATCGAGCTTTTTATTGTCATTGGAAACAAAAGAGCAAATGACTTTTG
:::::::::::::::::::::::::::::::.:::::::::::::::::::::::.::::::::::::::::::::::::::::::::::::::::::::
ATTCCAAGGTTAGAAGTCTAAAAATGGATGCCAGCATTTGGAGCAATGAACTCATTGAGCTTTTTATTGTCATTGGAAACAAAAGAGCAAATGACTTTTG
D--S--K--V--R--S--L--K--M--D--A--S--I--W--S--N--E--L--I--E--L--F--I--V--I--G--N--K--R--A--N--D--F--W

----------------------------------------------------------------------------------------------------
--A--G--N--L--Q--K--D--E--E--L--H--M--D--S--P--V--E--K--R--K--N--F--I--T--Q--K--Y--K--E--G--K--F--R-
GGCTGGTAATCTTCAAAAGGATGAAGAATTACATATGGACTCACCAGTAGAAAAGAGAAAAAACTTTATTACTCAGAAATATAAAGAAGGAAAATTCAGA
::::::::::::::::::.:: :::::::::::..::::::: ::::::::::::::::::::::::::.::::::::.::.:::::.::::.::::::.
GGCTGGTAATCTTCAAAAAGAGGAAGAATTACACGTGGACTCTCCAGTAGAAAAGAGAAAAAACTTTATCACTCAGAAGTACAAAGAGGGAAGATTCAGG
--A--G--N--L--Q--K--E--E--E--L--H--V--D--S--P--V--E--K--R--K--N--F--I--T--Q--K--Y--K--E--G--R--F--R-

-----------------------------------------><---------------------------------------------------------
-K--T--L--L--A--S--L--T--K--E--E--L--N--K--A--L--C--A--A--V--V--K--P--D--V--L--E--T--M--A--L--L--F--
AAAACTCTTTTGGCATCTCTCACCAAAGAAGAATTAAATAAGGCTCTATGTGCTGCTGTAGTGAAACCGGATGTTCTAGAAACAATGGCTTTGCTGTTCA
:::::.::.:::::::::::::::::.:::::.::::::::::::::.::::::::.::.:::::::::::::::::.::::::::::::::::::::::
AAAACCCTCTTGGCATCTCTCACCAAGGAAGAGTTAAATAAGGCTCTGTGTGCTGCCGTGGTGAAACCGGATGTTCTGGAAACAATGGCTTTGCTGTTCA
-K--T--L--L--A--S--L--T--K--E--E--L--N--K--A--L--C--A--A--V--V--K--P--D--V--L--E--T--M--A--L--L--F--

----------------------------------------------------------------------------------------------------
S--G--A--D--V--M--C--A--T--G--D--P--V--H--S--T--P--Y--L--L--A--K--K--A--G--Q--S--L--Q--M--E--F--L--Y
GTGGAGCAGATGTCATGTGTGCCACCGGAGACCCCGTGCATAGCACCCCCTATCTGCTAGCCAAGAAAGCTGGGCAAAGTCTGCAAATGGAATTTCTCTA
:::::::::::::.:::::::: :: :: ::.::.: :::::::::::::::::::::.::.:::::.:: :::::.::::::::.::::::::::::::
GTGGAGCAGATGTTATGTGTGCAACAGGTGATCCTGAGCATAGCACCCCCTATCTGCTGGCTAAGAAGGCAGGGCAGAGTCTGCAGATGGAATTTCTCTA
S--G--A--D--V--M--C--A--T--G--D--P--E--H--S--T--P--Y--L--L--A--K--K--A--G--Q--S--L--Q--M--E--F--L--Y

----------------><----------------------------------------------------------------------------------
--H--N--K--F--S--D--F--P--Q--H--D--I--H--S--E--G--V--L--S--Q--E--S--S--Q--S--T--F--L--C--D--F--L--Y-
CCATAACAAATTCTCAGATTTCCCTCAACATGATATTCATTCCGAGGGTGTATTAAGTCAAGAGTCTTCCCAGTCCACATTCCTCTGTGACTTTTTATAT
::::::::::::::::   :::::::::::.::.:: :::::.::.:::: :::::::::::::::.:::: .::::..:::::::::::::::::.:::
CCATAACAAATTCTCA---TTCCCTCAACACGACATACATTCTGAAGGTGGATTAAGTCAAGAGTCCTCCCCATCCATGTTCCTCTGTGACTTTTTGTAT
--H--N--K--F--S-----F--P--Q--H--D--I--H--S--E--G--G--L--S--Q--E--S--S--P--S--M--F--L--C--D--F--L--Y-

---------------------------------------------------><-----------------------------------------------
-Q--A--P--S--A--A--S--K--L--S--S--E--K--K--L--L--E--E--T--N--K--K--W--C--V--L--E--G--G--F--L--S--Y--
CAAGCTCCTTCTGCTGCTTCTAAACTCTCTTCAGAGAAAAAACTGCTTGAAGAGACAAATAAAAAATGGTGTGTTTTGGAAGGAGGCTTCTTGAGTTACT
::.:::::  :::::::::::::::::::::::::.:::::::::::::::   :::::::::::.::::::::::::::::::::::::::::::::::
CAGGCTCCAGCTGCTGCTTCTAAACTCTCTTCAGAAAAAAAACTGCTTGAA---ACAAATAAAAAGTGGTGTGTTTTGGAAGGAGGCTTCTTGAGTTACT
-Q--A--P--A--A--A--S--K--L--S--S--E--K--K--L--L--E-----T--N--K--K--W--C--V--L--E--G--G--F--L--S--Y--

------------------------------------------------------------------------------------------------><--
Y--E--N--D--K--S--T--T--P--N--G--T--I--N--I--N--E--V--I--C--L--A--I--H--K--E--D--F--Y--L--N--T--G--P
ATGAAAATGATAAGTCTACCACACCTAATGGCACCATTAATATCAATGAAGTTATCTGCCTGGCTATACACAAAGAGGACTTCTATTTAAATACTGGGCC
::::::.::::::::::::::  :::::::::::::::::::::::::: :::::::::::::::.:: :: ::::.:::::::.. ::::::::   ::
ATGAAAGTGATAAGTCTACCAACCCTAATGGCACCATTAATATCAATGATGTTATCTGCCTGGCTGTAAACCAAGAAGACTTCTGCATAAATACT---CC
Y--E--S--D--K--S--T--N--P--N--G--T--I--N--I--N--D--V--I--C--L--A--V--N--Q--E--D--F--C--I--N--T-----P

--------------------------------------------------------------------------------------------------->
--I--F--I--F--E--I--Y--L--P--S--E--R--V--F--L--F--G--A--E--T--S--Q--A--Q--R--K--W--T--E--A--I--A--K-
CATCTTTATCTTTGAGATCTACTTACCCTCCGAACGTGTGTTTTTATTTGGAGCTGAAACATCTCAAGCTCAAAGAAAATGGACAGAGGCAATAGCCAAG
::::::::.::::::::::::.:::::.:: :::::::..:::::::::::::::::::::::.::::::::.::::::::::::::.::::::::::::
CATCTTTACCTTTGAGATCTATTTACCTTCAGAACGTGCATTTTTATTTGGAGCTGAAACATCCCAAGCTCAGAGAAAATGGACAGAAGCAATAGCCAAG
--I--F--T--F--E--I--Y--L--P--S--E--R--A--F--L--F--G--A--E--T--S--Q--A--Q--R--K--W--T--E--A--I--A--K-

<---------------------------------------------------------------------------------------------------
-H--F--V--P--L--F--A--E--N--L--T--E--A--D--Y--D--L--I--G--Q--L--F--Y--K--D--C--H--A--L--D--Q--W--R--
CATTTTGTTCCCTTATTTGCTGAAAACTTAACAGAAGCTGACTATGATTTGATTGGTCAACTCTTCTACAAAGACTGCCATGCCCTGGATCAGTGGAGAA
::::::::::::::  :::::::::::::::::::::::::::::::::::::::::::::::: :::::::::::::::::::::::::::::::::::
CATTTTGTTCCCTTTGTTGCTGAAAACTTAACAGAAGCTGACTATGATTTGATTGGTCAACTCTACTACAAAGACTGCCATGCCCTGGATCAGTGGAGAA
-H--F--V--P--F--V--A--E--N--L--T--E--A--D--Y--D--L--I--G--Q--L--Y--Y--K--D--C--H--A--L--D--Q--W--R--

--------------------------------------------------------------------------------------------------><
K--G--W--F--A--M--D--K--S--S--L--H--F--C--L--Q--M--Q--E--V--Q--G--D--R--M--H--L--R--R--L--Q--E--L--T
AAGGCTGGTTTGCTATGGACAAATCCAGCTTGCATTTTTGCCTTCAAATGCAAGAAGTTCAGGGAGATAGAATGCACTTAAGAAGACTGCAAGAGCTAAC
:::::::::::::.:::::::::::.::.::::..:::::::::::::::::::::: :::::..::::::::: :::::::::::::::::::.:::  
AAGGCTGGTTTGCCATGGACAAATCTAGTTTGCGCTTTTGCCTTCAAATGCAAGAAGGTCAGGAGGATAGAATGAACTTAAGAAGACTGCAAGAACTA--
K--G--W--F--A--M--D--K--S--S--L--R--F--C--L--Q--M--Q--E--G--Q--E--D--R--M--N--L--R--R--L--Q--E--L---

--------------------------------------------------------------><------------------------------------
--I--S--T--M--V--Q--N--G--E--K--L--D--V--L--L--L--V--E--K--G--R--T--L--Y--I--H--G--H--T--K--L--D--F-
AATCAGCACAATGGTTCAAAATGGGGAAAAACTGGATGTTTTACTCTTGGTAGAAAAAGGGAGAACATTATACATCCATGGGCATACCAAGTTGGATTTC
 ::.::::::::::::::::::::.::::::::::::::.::.::::::::::::::::::   ::::::::::::::::::::::::::::::::::::
-ATTAGCACAATGGTTCAAAATGGAGAAAAACTGGATGTCTTGCTCTTGGTAGAAAAAGGG---ACATTATACATCCATGGGCATACCAAGTTGGATTTC
--I--S--T--M--V--Q--N--G--E--K--L--D--V--L--L--L--V--E--K--G-----T--L--Y--I--H--G--H--T--K--L--D--F-

----------------------------------------------------------------------------------------------------
-T--V--W--H--T--A--I--E--K--A--A--G--T--D--G--N--A--L--Q--D--Q--Q--L--S--K--N--D--V--P--I-----I--V--
ACAGTCTGGCATACTGCAATTGAAAAAGCAGCAGGTACAGATGGTAATGCTTTACAAGATCAGCAGCTCAGCAAAAATGACGTTCCCATT---ATAGTGA
:::::::::::::::::::::::::::::::::::::::::::::::::: :::::::::::::::::::::::::::::::::::::::      ::::
ACAGTCTGGCATACTGCAATTGAAAAAGCAGCAGGTACAGATGGTAATGCATTACAAGATCAGCAGCTCAGCAAAAATGACGTTCCCATTA--TGCGTGA
-T--V--W--H--T--A--I--E--K--A--A--G--T--D--G--N--A--L--Q--D--Q--Q--L--S--K--N--D--V--P--I--\--I--V--

-----------------------------><---------------------------------------------------------------------
N--S--C--I--A--F--V--T--Q--Y--G--L--G--C--K--Y--I--Y--Q--K--N--G--D--P--L--H--I--S--E--L--L--E--S--F
ACAGCTGTATAGCATTTGTTACACAGTATGGTTTAGGATGCAAATATATCTATCAAAAGAATGGTGATCCTTTGCATATAAGTGAACTCCTGGAGAGTTT
:::::::::::::::::::::::::::::   ::.::.:::::::::::::::::::::::::::::::::.::::.:::::::::::::::::::::::
ACAGCTGTATAGCATTTGTTACACAGTAT---TTGGGGTGCAAATATATCTATCAAAAGAATGGTGATCCTCTGCACATAAGTGAACTCCTGGAGAGTTT
N--S--C--I--A--F--V--T--Q--Y-----L--G--C--K--Y--I--Y--Q--K--N--G--D--P--L--H--I--S--E--L--L--E--S--F

----------------------------------------------------------------------------------------------------
--K--K--D--A--R--S--F--K--L--R--A--G--K--H--Q--L--E--D--V--T--A--V--L--K--S--F--L--S--D--I--D--D--A-
CAAAAAGGATGCAAGAAGCTTTAAATTGAGGGCTGGAAAACATCAGCTTGAAGATGTGACGGCTGTGTTGAAAAGTTTTCTCTCTGACATTGATGATGCA
:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: .::::::::. ::::::::::::::::::::::::::
CAAAAAGGATGCAAGAAGCTTTAAATTGAGGGCTGGAAAACATCAGCTTGAAGATGTGACGGGCGTGTTGAAGTGTTTTCTCTCTGACATTGATGATGCA
--K--K--D--A--R--S--F--K--L--R--A--G--K--H--Q--L--E--D--V--T--G--V--L--K--C--F--L--S--D--I--D--D--A-

------------------------------------------><--------------------------------------------------------
-L--L--T--K--E--L--Y--P--Y--W--I--S--A--L--D--T--Q--D--D--K--E--R--I--K--K--Y--G--A--F--I--R--S--L--
CTGCTTACTAAGGAGCTCTACCCATATTGGATCTCTGCTTTAGATACGCAAGATGACAAGGAAAGAATTAAAAAATATGGAGCATTTATACGTTCTCTTC
:: :::::.:::::::::::.:::::::::::::::::.:::                                                          
CTTCTTACCAAGGAGCTCTATCCATATTGGATCTCTGCCTTA----------------------------------------------------------
-L--L--T--K--E--L--Y--P--Y--W--I--S--A--L-----------------------------------------------------------

------------------------------------------------><--------------------------------------------------
P--G--V--N--R--A--T--L--A--A--I--I--E--H--L--Y--R--V--Q--K--C--S--E--I--N--H--M--N--A--H--N--L--A--L
CAGGGGTCAACCGAGCAACACTAGCAGCTATCATTGAACACCTGTATAGGGTTCAGAAATGCTCAGAAATCAATCACATGAATGCCCATAATTTGGCCTT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------------------------------------------------------------------------------------------><--
--V--F--S--S--C--L--F--Q--T--K--G--Q--T--S--E--E--V--N--V--I--E--D--L--I--N--N--Y--V--E--I--F--E--V-
GGTCTTTTCATCCTGTTTGTTTCAAACGAAGGGACAAACTAGTGAAGAAGTGAATGTAATTGAGGACCTAATTAATAATTATGTAGAAATATTTGAGGTT
                                                                                                 :::
-------------------------------------------------------------------------------------------------GTT
--------------------------------------------------------------------------------------------------V-

-----------------------------------------------------------------><---------------------------------
-K--E--D--Q--V--K--Q--M--D--I--E--N--S--F--I--T--K--W--K--D--T--Q--V--S--Q--A--G--D--L--L--I--E--V--
AAAGAAGATCAAGTCAAACAAATGGACATAGAAAATAGCTTTATTACCAAGTGGAAAGACACCCAAGTTTCCCAGGCTGGAGATTTGTTAATTGAAGTAT
::::::::.:::::::::::::::::::::::: ::::::::::::::::::::::::::::.:::      ::::::::::::::::::::::::::::
AAAGAAGACCAAGTCAAACAAATGGACATAGAATATAGCTTTATTACCAAGTGGAAAGACACTCAA------CAGGCTGGAGATTTGTTAATTGAAGTAT
-K--E--D--Q--V--K--Q--M--D--I--E--Y--S--F--I--T--K--W--K--D--T--Q--------Q--A--G--D--L--L--I--E--V--

----------------------------------------><----------------------------------------------------------
Y--V--E--R--K--E--P--D--C--S--I--I--I--R--I--S--P--V--M--E--A--E--E--L--T--N--D--I--L--A--I--K--N--I
ATGTAGAAAGGAAGGAACCCGACTGTAGTATTATAATTCGGATATCTCCTGTGATGGAAGCAGAAGAATTAACTAATGATATATTAGCGATAAAAAATAT
:::::::::::::::::::.:::::.:::::::::::.:::                                             ::::::::::::::
ATGTAGAAAGGAAGGAACCTGACTGCAGTATTATAATCCGG---------------------------------------------GCGATAAAAAATAT
Y--V--E--R--K--E--P--D--C--S--I--I--I--R-----------------------------------------------A--I--K--N--I

----------------------------------------------------------><----------------------------------------
--I--P--T--K--G--D--I--W--A--T--F--E--V--I--E--N--E--E--L--E--R--P--L--H--Y--K--E--N--V--L--E--Q--V-
TATTCCTACAAAAGGTGATATTTGGGCCACATTTGAAGTCATTGAAAATGAAGAGCTAGAGCGTCCTCTTCACTACAAGGAAAATGTACTGGAGCAGGTG
 :::::::..::::.::::::.:::::::::::::::::::: ::::::::::::                                             
AATTCCTATGAAAGATGATATCTGGGCCACATTTGAAGTCATAGAAAATGAAGAG---------------------------------------------
--I--P--M--K--D--D--I--W--A--T--F--E--V--I--E--N--E--E----------------------------------------------

---------------------------------------------------------------------------------------><-----------
-L--R--W--S--S--L--A--E--P--G--S--A--Y--L--V--V--K--R--F--L--T--A--D--T--I--K--H--C--S--D--R--S--T--
CTTCGGTGGAGTTCATTAGCTGAACCTGGCTCTGCTTACCTGGTGGTGAAGAGATTCTTAACCGCTGACACAATTAAACACTGCAGTGACCGGAGTACAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
L--G--S--I--K--E--G--I--L--K--I--K--E--E--P--S--K--I--L--S--G--N--K--F--Q--D--R--Y--F--V--L--R--D--G
TGGGAAGCATCAAAGAAGGAATCTTGAAAATCAAAGAAGAACCATCCAAAATACTATCTGGAAATAAGTTTCAAGACCGGTATTTTGTTTTACGAGATGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------------------------><-----------------------------------------------------------------------
--F--L--F--L--Y--K--D--V--K--S--S--K--H--D--K--M--F--S--L--S--S--M--K--F--Y--R--G--V--K--K--K--M--K-
GTTTCTCTTTCTTTACAAGGATGTGAAGAGTAGTAAACATGACAAGATGTTTTCTCTCAGTTCCATGAAGTTTTATCGTGGAGTGAAAAAGAAAATGAAG
                            ::.::::::: :::.::.:::.::::: ::::.:: ::::::::::::: :::::::::::::::.::::::
----------------------------AGCAGTAAACCTGATAAAATGCTTTCTGTCAGCTCAATGAAGTTTTATCTTGGAGTGAAAAAGAAGATGAAG
-----------------------------S--S--K--P--D--K--M--L--S--V--S--S--M--K--F--Y--L--G--V--K--K--K--M--K-

----------><----------------------------------><----------------------------------------------------
-P--P--T--S--W--G--L--T--A--Y--S--E--K--H--H--W--H--L--C--C--D--S--S--R--T--Q--T--E--W--M--T--S--I--
CCTCCAACAAGCTGGGGATTGACCGCATATTCTGAGAAACATCACTGGCACCTGTGTTGTGATAGTTCACGAACTCAGACGGAGTGGATGACCAGTATCT
:::::::::                                                                                           
CCTCCAACA-------------------------------------------------------------------------------------------
-P--P--T--------------------------------------------------------------------------------------------

----------><----------------------------------------------------------------------------------------
F--I--A--Q--H--E--Y--D--I--W--P--P--A--G--K--E--R--K--R--S--I--T--K--N--P--K--I--G--G--L--P--L--I--P
TTATTGCCCAGCATGAATATGATATATGGCCACCAGCTGGAAAGGAACGAAAACGTTCAATAACCAAAAATCCCAAAATTGGAGGTTTGCCTCTGATTCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------------------------------------------><-----------------------------------------------------
--I--Q--H--E--G--N--A--T--L--A--R--K--N--I--E--S--A--R--A--E--L--E--R--L--R--L--S--E--K--C--D--K--E-
TATACAGCATGAGGGGAATGCAACCTTGGCCCGGAAAAATATTGAGAGTGCAAGAGCAGAACTTGAAAGGCTGCGGCTCAGTGAAAAGTGTGATAAAGAG
                                              :::::::::::::::.: :::::.::: :::::.:.: ::::..:::   ::::
----------------------------------------------AGTGCAAGAGCAGAATTGGAAAGACTGAGGCTCGGCGCAAAGCATGAACTAGAG
-----------------------------------------------S--A--R--A--E--L--E--R--L--R--L--G--A--K--H--E--L--E-

----------------------------------------------------------------------------------------------------
-S--V--D--S--S--L--K--E--R--A--S--M--V--A--H--C--L--E--H--K--D--D--K--L--R--N--R--P--R--K--H--R--S--
TCCGTGGACTCTAGCTTAAAGGAGAGAGCTTCCATGGTGGCCCACTGCCTGGAGCACAAGGACGATAAACTTCGAAATCGACCCCGAAAACATCGGAGTT
...: :::.   : :::::::::::::::.::. : :::::.:: :::::::::::::::::.:: ::::::::::::::: :: :::::::::::::::
CTTGGGGATGGGACCTTAAAGGAGAGAGCCTCTCTCGTGGCTCAGTGCCTGGAGCACAAGGATGAGAAACTTCGAAATCGAACCAGAAAACATCGGAGTT
-L--G--D--G--T--L--K--E--R--A--S--L--V--A--Q--C--L--E--H--K--D--E--K--L--R--N--R--T--R--K--H--R--S--

----------------------------------------------------------------------------------------------------
F--N--C--L--E--D--T--E--P--E--A--P--L--G--Q--P--K--G--H--K--G--L--K--T--L--R--K--T--E--D--R--N--S--K
TCAACTGCCTGGAGGACACAGAGCCTGAAGCCCCACTTGGGCAACCAAAAGGCCATAAAGGCCTAAAGACATTGAGGAAGACTGAGGACAGGAATAGCAA
:::::::.::.::::::::.::: ::::.:.:.. :  ::::::  .:::.::::::::::. ::::::::::::::::.:::::.:::::::::.::::
TCAACTGTCTAGAGGACACGGAGACTGAGGTCTTTCAAGGGCAAGAGAAAAGCCATAAAGGTGTAAAGACATTGAGGAAAACTGAAGACAGGAATGGCAA
F--N--C--L--E--D--T--E--T--E--V--F--Q--G--Q--E--K--S--H--K--G--V--K--T--L--R--K--T--E--D--R--N--G--K

----------------------------------------------------------------------------------------------------
--A--T--L--D--S--D--H--K--L--P--S--R--V--I--E--E--L--N--V--V--L--Q--R--S--R--T--L--P--K--E--L--Q--D-
AGCTACTTTGGACTCTGATCATAAGTTACCATCAAGGGTAATTGAAGAACTTAATGTGGTTCTACAACGGTCAAGAACCCTTCCAAAAGAATTACAGGAT
::::::::::::::::.:: :::::::::::.:::.::: ::::::::.::::.::::::::::::.::::::::::.:::: :::::::.:::::::.:
AGCTACTTTGGACTCTAATAATAAGTTACCACCAAAGGTCATTGAAGAGCTTAGTGTGGTTCTACAGCGGTCAAGAATCCTTGCAAAAGAGTTACAGGGT
--A--T--L--D--S--N--N--K--L--P--P--K--V--I--E--E--L--S--V--V--L--Q--R--S--R--I--L--A--K--E--L--Q--G-

----------------->
-E--Q--I--L--K--*-
GAGCAGATTTTGAAGTAG
::::::::: :: ::   
GAGCAGATTGTGCAG---
-E--Q--I--V--Q----

Pig Consensus Sequence

>BGISUST0000879109
ATGTCCTCAGTCAGTGAAGTAAATGTGGATATCAAAGATTTCCTAATGAGCATTAATTTGGAGCAGTACCTCCTACGCTTCCGCGAGTTTGGTTTTAATA
ATGTGATGGACTGCACAGGGATAAATGACAGCGTGCTGCTCAAAGTTGGAATATCACCTACGGGACACAGGAGGAGGATACTTAAACAGTTACAGATAAT
CTTGTCAAAAATGCAAGATATCCCAGTCTATGCAAATGTTCACAAAGCAAAGAAGAGTGATGAGACCTCAGACGATCACCATGCTCCGCCTTCTGATCAG
AACCACTGC-------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
------------------------------------------------------------------TCAAATGAGGAGAATTCATCTTCCATTTTACCCT
ATGGAGAGACCTTTCTCTTCCAGAAACTAGAAAATTCTAAG-----------------------------------------------------------
----------------------------------ATATATGATAACAGGACAGAGAATATAACTGAAGACAAGGTGGAAGATATTTGGATACCTCGACAG
GACAAAAACAATCTTCCTATAGACTCTGCTTCAGAATCAGAATATTCAACAGTAGAAGAATGTTTTCAGAGTTTAAGAAGAAAAAATTCAAAGCCATCTA
AATCTCGGACCCAAAAAGCATTGAATTTGGACCCTGTTAATAGGCACAGTTATCCACTAAGTTCAACAAGTGGAAATGCTGATTCATCCATCATTTCTTC
AAATGTAATATCTCCTTATGCCTGTTTTTATGGATCTTCTGTAAAGAAGGTTAAATCTGGATGGCTAGACAAACTCTGTCCCCAA---------------
---------------------------------------------------------GAGAAGTATTCAAAAGGAATAATTCCCCTTTCTGCTATATCTA
CAGTACGAGTTCAAGGAGACAACAAATTTGAAGTTGTTACAACACAGAGAACTTTTGTTTTTAGAGTAGAAAAAGAA---GAGAGAAATGACTGGATCAG
CATACTGTTAAATGCACTGAAATTACAGGCCCTTTCCTCACAGTCTCAAGCAGCTGTTGCACCTGAGAAATGTGGATATCTTGAACTGAGAGGTTATAAA
GCCAAAATTTTTACTGTGTTAAGTGGGAACAGTGTGTGGCTCTGCAAAAATGAACAG-------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
---------------------------------------------------------------------------CAACATAGATCTTTAGGACCAAAAG
ATTCCAAGGTTAGAAGTCTAAAAATGGATGCCAGCATTTGGAGCAATGAACTCATTGAGCTTTTTATTGTCATTGGAAACAAAAGAGCAAATGACTTTTG
GGCTGGTAATCTTCAAAAAGAGGAAGAATTACACGTGGACTCTCCAGTAGAAAAGAGAAAAAACTTTATCACTCAGAAGTACAAAGAGGGAAGATTCAGG
AAAACCCTCTTGGCATCTCTCACCAAGGAAGAGTTAAATAAGGCTCTGTGTGCTGCCGTGGTGAAACCGGATGTTCTGGAAACAATGGCTTTGCTGTTCA
GTGGAGCAGATGTTATGTGTGCAACAGGTGATCCTGAGCATAGCACCCCCTATCTGCTGGCTAAGAAGGCAGGGCAGAGTCTGCAGATGGAATTTCTCTA
CCATAACAAATTCTCA---TTCCCTCAACACGACATACATTCTGAAGGTGGATTAAGTCAAGAGTCCTCCCCATCCATGTTCCTCTGTGACTTTTTGTAT
CAGGCTCCAGCTGCTGCTTCTAAACTCTCTTCAGAAAAAAAACTGCTTGAA---ACAAATAAAAAGTGGTGTGTTTTGGAAGGAGGCTTCTTGAGTTACT
ATGAAAGTGATAAGTCTACCAACCCTAATGGCACCATTAATATCAATGATGTTATCTGCCTGGCTGTAAACCAAGAAGACTTCTGCATAAATACT---CC
CATCTTTACCTTTGAGATCTATTTACCTTCAGAACGTGCATTTTTATTTGGAGCTGAAACATCCCAAGCTCAGAGAAAATGGACAGAAGCAATAGCCAAG
CATTTTGTTCCCTTTGTTGCTGAAAACTTAACAGAAGCTGACTATGATTTGATTGGTCAACTCTACTACAAAGACTGCCATGCCCTGGATCAGTGGAGAA
AAGGCTGGTTTGCCATGGACAAATCTAGTTTGCGCTTTTGCCTTCAAATGCAAGAAGGTCAGGAGGATAGAATGAACTTAAGAAGACTGCAAGAACTA--
-ATTAGCACAATGGTTCAAAATGGAGAAAAACTGGATGTCTTGCTCTTGGTAGAAAAAGGG---ACATTATACATCCATGGGCATACCAAGTTGGATTTC
ACAGTCTGGCATACTGCAATTGAAAAAGCAGCAGGTACAGATGGTAATGCATTACAAGATCAGCAGCTCAGCAAAAATGACGTTCCCATttGCGTGAACA
GCTGTATAGCATTTGTTACACAGTAT---TTGGGGTGCAAATATATCTATCAAAAGAATGGTGATCCTCTGCACATAAGTGAACTCCTGGAGAGTTTCAA
AAAGGATGCAAGAAGCTTTAAATTGAGGGCTGGAAAACATCAGCTTGAAGATGTGACGGGCGTGTTGAAGTGTTTTCTCTCTGACATTGATGATGCACTT
CTTACCAAGGAGCTCTATCCATATTGGATCTCTGCCTTA-------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------GTTAAA
GAAGACCAAGTCAAACAAATGGACATAGAATATAGCTTTATTACCAAGTGGAAAGACACTCAA------CAGGCTGGAGATTTGTTAATTGAAGTATATG
TAGAAAGGAAGGAACCTGACTGCAGTATTATAATCCGG---------------------------------------------GCGATAAAAAATATAAT
TCCTATGAAAGATGATATCTGGGCCACATTTGAAGTCATAGAAAATGAAGAG------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-------------------------AGCAGTAAACCTGATAAAATGCTTTCTGTCAGCTCAATGAAGTTTTATCTTGGAGTGAAAAAGAAGATGAAGCCT
CCAACA----------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-------------------------------------------AGTGCAAGAGCAGAATTGGAAAGACTGAGGCTCGGCGCAAAGCATGAACTAGAGCTT
GGGGATGGGACCTTAAAGGAGAGAGCCTCTCTCGTGGCTCAGTGCCTGGAGCACAAGGATGAGAAACTTCGAAATCGAACCAGAAAACATCGGAGTTTCA
ACTGTCTAGAGGACACGGAGACTGAGGTCTTTCAAGGGCAAGAGAAAAGCCATAAAGGTGTAAAGACATTGAGGAAAACTGAAGACAGGAATGGCAAAGC
TACTTTGGACTCTAATAATAAGTTACCACCAAAGGTCATTGAAGAGCTTAGTGTGGTTCTACAGCGGTCAAGAATCCTTGCAAAAGAGTTACAGGGTGAG
CAGATTGTGCAG---


>BGISUSP0000879109
MSSVSEVNVDIKDFLMSINLEQYLLRFREFGFNNVMDCTGINDSVLLKVGISPTGHRRRILKQLQIILSKMQDIPVYANVHKAKKSDETSDDHHAPPSDQ
NHC-------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------SNEENSSSILPYGETFLFQKLENSK-------------------------------IYDNRTENITEDKVEDIWIPRQ
DKNNLPIDSASESEYSTVEECFQSLRRKNSKPSKSRTQKALNLDPVNRHSYPLSSTSGNADSSIISSNVISPYACFYGSSVKKVKSGWLDKLCPQ-----
-------------------EKYSKGIIPLSAISTVRVQGDNKFEVVTTQRTFVFRVEKE-ERNDWISILLNALKLQALSSQSQAAVAPEKCGYLELRGYK
AKIFTVLSGNSVWLCKNEQ---------------------------------------------------------------------------------
-------------------------QHRSLGPKDSKVRSLKMDASIWSNELIELFIVIGNKRANDFWAGNLQKEEELHVDSPVEKRKNFITQKYKEGRFR
KTLLASLTKEELNKALCAAVVKPDVLETMALLFSGADVMCATGDPEHSTPYLLAKKAGQSLQMEFLYHNKFS-FPQHDIHSEGGLSQESSPSMFLCDFLY
QAPAAASKLSSEKKLLE-TNKKWCVLEGGFLSYYESDKSTNPNGTININDVICLAVNQEDFCINT-PIFTFEIYLPSERAFLFGAETSQAQRKWTEAIAK
HFVPFVAENLTEADYDLIGQLYYKDCHALDQWRKGWFAMDKSSLRFCLQMQEGQEDRMNLRRLQEL-ISTMVQNGEKLDVLLLVEKG-TLYIHGHTKLDF
TVWHTAIEKAAGTDGNALQDQQLSKNDVPICVNSCIAFVTQY-LGCKYIYQKNGDPLHISELLESFKKDARSFKLRAGKHQLEDVTGVLKCFLSDIDDAL
LTKELYPYWISAL-------------------------------------------------------------------------------------VK
EDQVKQMDIEYSFITKWKDTQ--QAGDLLIEVYVERKEPDCSIIIR---------------AIKNIIPMKDDIWATFEVIENEE----------------
---------------------------------------------------------------------------SSKPDKMLSVSSMKFYLGVKKKMKP
PT-------------------------------------------------------------------------------SARAELERLRLGAKHELEL
GDGTLKERASLVAQCLEHKDEKLRNRTRKHRSFNCLEDTETEVFQGQEKSHKGVKTLRKTEDRNGKATLDSNNKLPPKVIEELSVVLQRSRILAKELQGE
QIVQ-