Sequences
EST Library Info
cbe3Cerebellum
cki1Kidney - RNA from China
cst1Stomach - RNA from China
fat5Fatt
nco1Newborn 115 days, colon
tra1Trachea
Clusters
Oligos
SNPs

Gene ID ENSG00000168092 (click for geneview)
Transcript ID ENST00000304808(link to ensembl)
Symbol PAFAH1B2
Localtion Chromosome:11:116528374:116543625:1 band: 11q23.3
Description Platelet-activating factor acetylhydrolase IB beta subunit (EC 3.1.1.47) (PAF acetylhydrolase 30 kDa subunit) (PAF-AH 30 kDa subunit) (PAF-AH beta subunit) (PAFAH beta subunit).
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-------------------------------------------------------------------------------><------------------
-M--S--Q--G--D--S--N--P--A--A--I--P--H--A--A--E--D--I--Q--G--D--D--R--W--M--S--Q--H--N--R--F--V--L--
ATGAGCCAAGGAGACTCAAACCCAGCAGCTATTCCGCATGCAGCAGAAGATATTCAAGGAGATGACCGATGGATGTCTCAGCACAACAGATTTGTTTTGG
   . : :.::::::::::::::::::::.:::::.:::::::::::::::::::::::::::::: :::::::::: :::   :.:::::::::..:::
---GCCAAGGGAGACTCAAACCCAGCAGCCATTCCACATGCAGCAGAAGATATTCAAGGAGATGACAGATGGATGTCACAG---AGCAGATTTGTCCTGG
----A--K--G--D--S--N--P--A--A--I--P--H--A--A--E--D--I--Q--G--D--D--R--W--M--S--Q-----S--R--F--V--L--

----------------------------------------------------------------------><----------------------------
D--C--K--D--K--E--P--D--V--L--F--V--G--D--S--M--V--Q--L--M--Q--Q--Y--E--I--W--R--E--L--F--S--P--L--H
ACTGTAAAGACAAAGAGCCTGATGTACTGTTCGTGGGAGACTCCATGGTGCAGTTAATGCAGCAATATGAGATATGGCGAGAGCTTTTTTCCCCACTTCA
:.::.:::::::::::::: ::::: :::::.:::::.:::::::::::::::::.:::::.::.:::::::::::::::::::::::::::::::::::
ATTGCAAAGACAAAGAGCCGGATGTCCTGTTTGTGGGGGACTCCATGGTGCAGTTGATGCAACAGTATGAGATATGGCGAGAGCTTTTTTCCCCACTTCA
D--C--K--D--K--E--P--D--V--L--F--V--G--D--S--M--V--Q--L--M--Q--Q--Y--E--I--W--R--E--L--F--S--P--L--H

---------------------------------------------------------------------------------------><-----------
--A--L--N--F--G--I--G--G--D--T--T--R--H--V--L--W--R--L--K--N--G--E--L--E--N--I--K--P--K--V--I--V--V-
TGCACTGAATTTTGGAATTGGGGGAGATACAACAAGACATGTTTTGTGGAGACTAAAGAATGGAGAACTGGAGAATATTAAGCCTAAGGTCATTGTTGTC
:::::::::::::::::::::::::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::.::::::::::::::::::
TGCACTGAATTTTGGAATTGGGGGAGATACAACAAGACATGTTTTATGGAGACTAAAGAATGGAGAACTGGAGAATATTAAACCTAAGGTCATTGTTGTC
--A--L--N--F--G--I--G--G--D--T--T--R--H--V--L--W--R--L--K--N--G--E--L--E--N--I--K--P--K--V--I--V--V-

----------------------------------------------------------------------------------------------------
-W--V--G--T--N--N--H--E--N--T--A--E--E--V--A--G--G--I--E--A--I--V--Q--L--I--N--T--R--Q--P--Q--A--K--
TGGGTAGGAACAAATAACCACGAAAATACAGCAGAAGAAGTAGCAGGTGGGATCGAGGCCATTGTACAACTTATCAACACAAGGCAGCCACAGGCCAAAA
::::::::::::::.:::::.::::::::::::::.:::::::: :::::.:::::::::::::::::::::::::::::::::::::: ::::::::::
TGGGTAGGAACAAACAACCATGAAAATACAGCAGAGGAAGTAGCCGGTGGAATCGAGGCCATTGTACAACTTATCAACACAAGGCAGCCCCAGGCCAAAA
-W--V--G--T--N--N--H--E--N--T--A--E--E--V--A--G--G--I--E--A--I--V--Q--L--I--N--T--R--Q--P--Q--A--K--

----------><----------------------------------------------------------------------------------------
I--I--V--L--G--L--L--P--R--G--E--K--P--N--P--L--R--Q--K--N--A--K--V--N--Q--L--L--K--V--S--L--P--K--L
TCATTGTATTGGGTTTGTTACCTCGAGGTGAGAAACCCAATCCTTTGAGGCAAAAGAACGCCAAGGTGAACCAACTCCTCAAGGTTTCGCTGCCGAAGCT
::::::::::::::::::::::::::::::::::.:::::.:::::::::::::::::.:: :::::::::::.:::::::::::.:: :::::.:::::
TCATTGTATTGGGTTTGTTACCTCGAGGTGAGAAGCCCAACCCTTTGAGGCAAAAGAATGCGAAGGTGAACCAGCTCCTCAAGGTCTCCCTGCCAAAGCT
I--I--V--L--G--L--L--P--R--G--E--K--P--N--P--L--R--Q--K--N--A--K--V--N--Q--L--L--K--V--S--L--P--K--L

----------------------------------------------------------------------------------------------------
--A--N--V--Q--L--L--D--T--D--G--G--F--V--H--S--D--G--A--I--S--C--H--D--M--F--D--F--L--H--L--T--G--G-
TGCCAACGTGCAGCTCCTGGATACCGACGGGGGTTTTGTGCACTCGGACGGTGCCATCTCCTGCCACGACATGTTTGATTTTCTGCATCTGACAGGAGGG
::::::.:: ::.::::::::::: ::.:::::.::.::::::::::::::::::::::::::::::::::::::::::::::::::::: :::::::::
TGCCAATGTTCAACTCCTGGATACAGATGGGGGCTTCGTGCACTCGGACGGTGCCATCTCCTGCCACGACATGTTTGATTTTCTGCATCTCACAGGAGGG
--A--N--V--Q--L--L--D--T--D--G--G--F--V--H--S--D--G--A--I--S--C--H--D--M--F--D--F--L--H--L--T--G--G-

----------------------------------------------------------------------------------------->
-G--Y--A--K--I--C--K--P--L--H--E--L--I--M--Q--L--L--E--E--T--P--E--E--K--Q--T--T--I--A--*-
GGCTATGCAAAGATCTGCAAACCCCTGCATGAACTGATCATGCAGTTGTTGGAGGAAACACCTGAGGAGAAACAAACCACCATTGCCTGA
:::::.:::::::::::::::::::: :::::::::::.:::::::::::::::::::::::::::::.:::::::::::::::::::::
GGCTACGCAAAGATCTGCAAACCCCTCCATGAACTGATTATGCAGTTGTTGGAGGAAACACCTGAGGAAAAACAAACCACCATTGCCTGA
-G--Y--A--K--I--C--K--P--L--H--E--L--I--M--Q--L--L--E--E--T--P--E--E--K--Q--T--T--I--A--*-

Pig Consensus Sequence

>BGISUST0000886504
---GCCAAGGGAGACTCAAACCCAGCAGCCATTCCACATGCAGCAGAAGATATTCAAGGAGATGACAGATGGATGTCACAG---AGCAGATTTGTCCTGG
ATTGCAAAGACAAAGAGCCGGATGTCCTGTTTGTGGGGGACTCCATGGTGCAGTTGATGCAACAGTATGAGATATGGCGAGAGCTTTTTTCCCCACTTCA
TGCACTGAATTTTGGAATTGGGGGAGATACAACAAGACATGTTTTATGGAGACTAAAGAATGGAGAACTGGAGAATATTAAACCTAAGGTCATTGTTGTC
TGGGTAGGAACAAACAACCATGAAAATACAGCAGAGGAAGTAGCCGGTGGAATCGAGGCCATTGTACAACTTATCAACACAAGGCAGCCCCAGGCCAAAA
TCATTGTATTGGGTTTGTTACCTCGAGGTGAGAAGCCCAACCCTTTGAGGCAAAAGAATGCGAAGGTGAACCAGCTCCTCAAGGTCTCCCTGCCAAAGCT
TGCCAATGTTCAACTCCTGGATACAGATGGGGGCTTCGTGCACTCGGACGGTGCCATCTCCTGCCACGACATGTTTGATTTTCTGCATCTCACAGGAGGG
GGCTACGCAAAGATCTGCAAACCCCTCCATGAACTGATTATGCAGTTGTTGGAGGAAACACCTGAGGAAAAACAAACCACCATTGCCTGA


>BGISUSP0000886504
-AKGDSNPAAIPHAAEDIQGDDRWMSQ-SRFVLDCKDKEPDVLFVGDSMVQLMQQYEIWRELFSPLHALNFGIGGDTTRHVLWRLKNGELENIKPKVIVV
WVGTNNHENTAEEVAGGIEAIVQLINTRQPQAKIIVLGLLPRGEKPNPLRQKNAKVNQLLKVSLPKLANVQLLDTDGGFVHSDGAISCHDMFDFLHLTGG
GYAKICKPLHELIMQLLEETPEEKQTTIA*