Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000168781 (click for geneview)
Transcript ID ENST00000304953(link to ensembl)
Symbol Q6PFW1_HUMAN
Localtion Chromosome:15:41612967:41769529:-1 band: 15q15.3
Description KIAA0377 gene product
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--W--S--L--T--A--S--E--G--E--S--T--T--A--H--F--F--L--G--A--G--D--E--G--L--G--T--R--G--I--G--M--R--
ATGTGGTCATTGACGGCCAGTGAGGGCGAGAGTACCACGGCCCACTTCTTCCTTGGAGCTGGAGATGAGGGGCTGGGCACCCGTGGAATAGGCATGAGGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------><----------------------------------------------------
P--E--E--S--D--S--E--L--L--E--D--E--E--D--E--V--P--P--E--P--Q--I--I--V--G--I--C--A--M--T--K--K--S--K
CAGAAGAGAGTGACAGCGAGCTCCTTGAGGATGAGGAGGATGAAGTGCCTCCTGAACCTCAGATCATTGTTGGCATCTGTGCCATGACCAAGAAATCCAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--S--K--P--M--T--Q--I--L--E--R--L--C--R--F--D--Y--L--T--V--V--I--L--G--E--D--V--I--L--N--E--P--V--E-
GTCCAAGCCAATGACTCAAATCCTAGAGCGACTCTGCAGATTTGACTACCTGACTGTTGTCATTCTGGGAGAAGATGTAATCCTTAATGAACCTGTGGAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------------------------------------><--------------------------------------------------------
-N--W--P--S--C--H--C--L--I--S--F--H--S--K--G--F--P--L--D--K--A--V--A--Y--S--K--L--R--N--P--F--L--I--
AACTGGCCATCCTGCCACTGCCTCATCTCTTTCCACTCCAAAGGCTTTCCTCTGGACAAAGCTGTTGCTTACTCCAAGCTTCGAAACCCCTTTCTTATCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------------------------------><-----------------------------------------------------------------
N--D--L--A--M--Q--Y--Y--I--Q--D--R--R--E--V--Y--R--I--L--Q--E--E--G--I--D--L--P--R--Y--A--V--L--N--R
ATGATCTGGCCATGCAGTATTACATCCAAGATAGGAGGGAGGTGTACCGGATCCTGCAGGAAGAGGGTATTGATCTGCCTCGATATGCTGTGCTCAACCG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------><-------------------------------------------------------------------------------
--D--P--A--R--P--E--E--C--N--L--I--E--G--E--D--Q--V--E--V--N--G--A--V--F--P--K--P--F--V--E--K--P--V-
TGATCCTGCCCGGCCTGAGGAATGCAACCTGATAGAAGGTGAAGACCAAGTAGAGGTCAATGGAGCTGTCTTTCCCAAGCCCTTTGTGGAGAAGCCAGTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------------------------------------------------------------><------------------------
-S--A--E--D--H--N--V--Y--I--Y--Y--P--S--S--A--G--G--G--S--Q--R--L--F--R--K--I--G--S--R--S--S--V--Y--
AGTGCAGAAGACCACAATGTTTACATCTACTACCCCAGCTCAGCTGGAGGAGGAAGCCAGCGTCTCTTTCGTAAGATTGGCAGCCGAAGCAGTGTTTACT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------><----------------------
S--P--E--S--S--V--R--K--T--G--S--Y--I--Y--E--E--F--M--P--T--D--G--T--D--V--K--V--Y--T--V--G--P--D--Y
CTCCTGAGAGCAGCGTCCGAAAGACGGGGTCGTACATCTATGAGGAGTTTATGCCAACAGATGGCACAGATGTCAAGGTGTATACAGTGGGGCCAGATTA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--A--H--A--E--A--R--K--S--P--A--L--D--G--K--V--E--R--D--S--E--G--K--E--I--R--Y--P--V--M--L--T--A--M-
TGCCCATGCTGAAGCTAGAAAATCTCCAGCTTTGGATGGGAAGGTTGAACGAGACAGTGAGGGGAAAGAGATTCGATATCCAGTCATGCTGACTGCCATG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------------------------><------------------------------------------------------------
-E--K--L--V--A--R--K--V--C--V--A--F--K--Q--T--V--C--G--F--D--L--L--R--A--N--G--H--S--F--V--C--D--V--
GAAAAGCTGGTGGCCAGGAAAGTCTGCGTAGCTTTCAAGCAAACAGTTTGTGGATTTGACCTTCTTCGTGCCAATGGTCATTCCTTTGTGTGTGATGTCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------------------------------------------------------><--------------------------------------
N--G--F--S--F--V--K--N--S--M--K--Y--Y--D--D--C--A--K--I--L--G--N--T--I--M--R--E--L--A--P--Q--F--Q--I
ATGGCTTTAGTTTTGTCAAGAACTCGATGAAATACTACGATGACTGTGCCAAGATTCTGGGGAACACCATAATGCGGGAGCTTGCCCCACAGTTCCAGAT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------------------------------------------------><------------------------------------
--P--W--S--I--P--T--E--A--E--D--I--P--I--V--P--T--T--S--G--T--M--M--E--L--R--C--V--I--A--I--I--R--H-
TCCATGGTCCATCCCCACGGAGGCTGAGGACATTCCCATTGTTCCCACCACATCTGGCACTATGATGGAACTTCGTTGTGTCATTGCAATTATTCGTCAT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------------------------------><-------------------------------------------------
-G--D--R--T--P--K--Q--K--M--K--M--E--V--K--H--P--R--F--F--A--L--F--E--K--H--G--G--Y--K--T--G--K--L--
GGGGATCGTACTCCCAAGCAGAAGATGAAGATGGAAGTGAAACACCCAAGGTTTTTTGCTCTGTTTGAAAAACATGGTGGCTACAAGACAGGGAAATTAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------><-------------------------------------------------------------------------
K--L--K--R--P--E--Q--L--Q--E--V--L--D--I--T--R--L--L--L--A--E--L--E--K--E--P--G--G--E--I--E--E--K--T
AACTCAAGCGACCTGAGCAGCTCCAGGAGGTGCTGGATATCACAAGGCTGTTGTTGGCTGAACTGGAGAAAGAACCAGGTGGTGAGATCGAGGAGAAGAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----------------------------------><---------------------------------------------------------------
--G--K--L--E--Q--L--K--S--V--L--E--M--Y--G--H--F--S--G--I--N--R--K--V--Q--L--T--Y--Y--P--H--G--V--K-
TGGAAAACTAGAGCAGCTGAAGTCTGTACTGGAGATGTATGGTCACTTCTCAGGTATAAACCGGAAGGTACAATTGACTTACTACCCTCATGGAGTAAAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------------><--------------------------------------------------------------------------------
-A--S--N--E--G--Q--D--P--Q--R--E--T--L--A--P--S--L--L--L--V--L--K--W--G--G--E--L--T--P--A--G--R--V--
GCTTCTAATGAGGGGCAAGATCCACAGAGGGAAACTCTGGCCCCATCTCTGTTGCTGGTACTGAAGTGGGGTGGAGAACTGACTCCTGCTGGCCGTGTTC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------------------------------------><------------------------------------------------
Q--A--E--E--L--G--R--A--F--R--C--M--Y--P--G--G--Q--G--D--Y--A--G--F--P--G--C--G--L--L--R--L--H--S--T
AGGCTGAGGAGCTGGGGCGAGCTTTTCGCTGCATGTACCCTGGAGGACAGGGTGACTATGCTGGCTTCCCTGGTTGTGGGCTGCTTCGTCTCCATAGCAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------------------------------------------------------------------><--------------------------
--F--R--H--D--L--K--I--Y--A--S--D--E--G--R--V--Q--M--T--A--A--A--F--A--K--G--L--L--A--L--E--G--E--L-
TTTCCGCCACGATCTCAAGATCTATGCCTCTGATGAGGGTCGTGTTCAGATGACTGCTGCTGCCTTCGCCAAGGGCCTTCTGGCTCTAGAAGGGGAGCTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-T--P--I--L--V--Q--M--V--K--S--A--N--M--N--G--L--L--D--S--D--G--D--S--L--S--S--C--Q--H--R--V--K--A--
ACACCCATTTTGGTGCAAATGGTGAAGAGTGCCAACATGAATGGGCTACTGGACAGCGATGGGGATTCCTTGAGCAGCTGCCAGCACCGGGTGAAGGCTC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------------------------------------><-------------------------------------------
R--L--H--H--I--L--Q--Q--D--A--P--F--G--P--E--D--Y--D--Q--L--A--P--T--R--S--T--S--L--L--N--S--M--T--I
GGCTGCACCATATTCTACAGCAGGATGCGCCCTTTGGCCCTGAGGACTACGATCAGCTGGCTCCCACCAGAAGTACTTCCCTGCTCAACTCCATGACTAT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------------------------------------------------------------------------------><-
--I--Q--N--P--V--K--V--C--D--Q--V--F--A--L--I--E--N--L--T--H--Q--I--R--E--R--M--Q--D--P--R--S--V--D-
CATCCAGAATCCTGTGAAGGTCTGTGATCAGGTATTTGCCCTGATCGAAAACCTCACCCACCAGATCCGGGAACGAATGCAGGACCCCAGGTCTGTAGAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-L--Q--L--Y--H--S--E--T--L--E--L--M--L--Q--R--W--S--K--L--E--R--D--F--R--Q--K--S--G--R--Y--D--I--S--
CTGCAGCTCTACCACAGTGAGACACTAGAGCTAATGCTACAGCGTTGGAGCAAGCTGGAGCGTGACTTTCGACAGAAGAGTGGGCGCTATGATATCAGTA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
K--I--P--D--I--Y--D--C--V--K--Y--D--V--Q--H--N--G--S--L--G--L--Q--G--T--A--E--L--L--R--L--S--K--A--L
AGATCCCTGACATCTATGACTGTGTCAAGTATGATGTGCAGCACAATGGGAGTCTGGGACTTCAAGGCACAGCAGAGTTGCTCCGTCTCTCTAAGGCACT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------------------><-----------------------------------------------------------------------------
--A--D--V--V--I--P--Q--E--Y--G--I--S--R--E--E--K--L--E--I--A--V--G--F--C--L--P--L--L--R--K--I--L--L-
GGCTGATGTGGTCATTCCCCAGGAGTACGGGATCAGTCGGGAGGAGAAACTGGAAATTGCTGTGGGCTTCTGTCTTCCACTGTTGCGGAAGATACTACTT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------------------------------><-------------------------------------------------
-D--L--Q--R--T--H--E--D--E--S--V--N--K--L--H--P--L--C--Y--L--R--Y--S--R--G--V--L--S--P--G--R--H--V--
GACCTGCAGAGAACCCACGAGGATGAGTCTGTCAACAAGCTGCATCCCCTCTGTTATCTCAGGTACTCCCGAGGCGTGCTCTCCCCAGGTCGCCACGTTC
                                                   ::::::::::::::::::::::: ::::::::::::::.::::::::::
---------------------------------------------------TGTTATCTCAGGTACTCCCGAGGAGTGCTCTCCCCAGGCCGCCACGTTC
----------------------------------------------------C--Y--L--R--Y--S--R--G--V--L--S--P--G--R--H--V--

----------------------------------------------------------------------------><----------------------
R--T--R--L--Y--F--T--S--E--S--H--V--H--S--L--L--S--V--F--R--Y--G--G--L--L--D--E--T--Q--D--A--Q--W--Q
GAACGCGTCTCTATTTCACCAGTGAGAGCCATGTCCACTCCCTGCTCAGTGTCTTCCGTTATGGAGGACTTCTTGATGAGACCCAGGATGCACAATGGCA
:::: :::::::::::.::::::::::::::.:::::::::.:::::::::::::::: :::::.:::::::::::::::::: ::::::::::.:::::
GAACTCGTCTCTATTTTACCAGTGAGAGCCACGTCCACTCCTTGCTCAGTGTCTTCCGATATGGGGGACTTCTTGATGAGACCAAGGATGCACAGTGGCA
R--T--R--L--Y--F--T--S--E--S--H--V--H--S--L--L--S--V--F--R--Y--G--G--L--L--D--E--T--K--D--A--Q--W--Q

------------------------------------------------------------------------------------><--------------
--R--A--L--D--Y--L--S--A--I--S--E--L--N--Y--M--T--Q--I--V--I--M--L--Y--E--D--N--T--Q--D--P--L--S--E-
GCGAGCTTTGGATTATCTTAGTGCCATCTCAGAGCTTAACTACATGACCCAGATTGTCATCATGCTTTATGAGGACAACACACAGGATCCCTTATCAGAG
::::::::::: ::::::::::::::::::::::::.::::::::::::::::::::::::::::::::::::::::::::::.:               
GCGAGCTTTGGCTTATCTTAGTGCCATCTCAGAGCTCAACTACATGACCCAGATTGTCATCATGCTTTATGAGGACAACACACGG---------------
--R--A--L--A--Y--L--S--A--I--S--E--L--N--Y--M--T--Q--I--V--I--M--L--Y--E--D--N--T--R----------------

----------------------------------------------------------------------------------------------------
-E--R--F--H--V--E--L--H--F--S--P--G--V--K--G--V--E--E--E--G--S--A--P--A--G--C--G--F--R--P--A--S--S--
GAACGGTTCCATGTGGAGCTACACTTCAGCCCCGGAGTGAAAGGTGTTGAGGAAGAAGGCAGTGCCCCGGCTGGCTGTGGATTCCGTCCAGCCTCTTCTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-><-------------------------------------------------------------------------------------------------
E--N--E--E--M--K--T--N--Q--G--S--M--E--N--L--C--P--G--K--A--S--D--E--P--D--R--A--L--Q--T--S--P--Q--P
AGAATGAGGAGATGAAAACCAACCAAGGCAGTATGGAGAACCTGTGTCCAGGAAAGGCATCAGATGAACCAGACCGGGCATTGCAGACTTCACCCCAGCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------------------------------------------------------------><--------------------------------
--P--E--G--P--G--L--P--R--R--S--P--L--I--R--N--R--K--A--G--S--M--E--V--L--S--E--T--S--S--S--R--P--G-
TCCTGAGGGCCCTGGCCTTCCGAGGAGATCACCCCTCATTCGTAACCGAAAAGCTGGTTCCATGGAGGTACTTTCTGAGACTTCATCCTCGAGGCCTGGT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------------------------------------------------------><-----------------------------------------
-G--Y--R--L--F--S--S--S--R--P--P--T--E--M--K--Q--S--G--L--G--S--Q--C--T--G--L--F--S--T--T--V--L--G--
GGCTACCGGCTCTTTTCATCTTCACGGCCACCCACAGAAATGAAGCAGAGTGGCCTAGGCTCACAGTGCACAGGGCTGTTCAGCACCACAGTGCTGGGTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----------------------------------------------------------------------------------><---------------
G--S--S--S--A--P--N--L--Q--D--Y--A--R--S--H--G--K--K--L--P--P--A--S--L--K--H--R--D--E--L--L--F--V--P
GCTCCTCCAGTGCCCCGAATCTTCAGGACTACGCCCGCAGCCATGGCAAAAAGCTACCACCTGCCAGTCTGAAGCACCGAGATGAGCTCTTGTTTGTCCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------><----------------------------------------------------
--A--V--K--R--F--S--V--S--F--A--K--H--P--T--N--G--F--E--G--C--S--M--V--P--T--I--Y--P--L--E--T--L--H-
GGCCGTAAAACGATTTTCTGTGTCGTTTGCAAAGCATCCGACTAACGGGTTTGAAGGGTGTTCCATGGTGCCTACCATCTACCCTCTGGAAACACTGCAT
                                                 ::.:::::::::::::::::.::::::::.:::::.:::::::: ::::::
-------------------------------------------------TTCGAAGGGTGTTCCATGGTACCTACCATTTACCCCCTGGAAACTCTGCAT
--------------------------------------------------F--E--G--C--S--M--V--P--T--I--Y--P--L--E--T--L--H-

------------------------------------------------------------------------------------><--------------
-N--A--L--S--L--R--Q--V--S--E--F--L--S--R--V--C--Q--R--H--T--D--A--Q--A--Q--A--S--A--A--L--F--D--S--
AATGCCCTTTCCCTACGTCAAGTGAGTGAATTCTTGAGTAGAGTCTGCCAGCGCCACACTGATGCCCAGGCACAGGCATCTGCAGCCCTCTTTGATTCCA
:::::::::::.::.:::::::::::::::::::::::::::::::::::::::::::::::::::::.:::::::::::::::                
AATGCCCTTTCTCTGCGTCAAGTGAGTGAATTCTTGAGTAGAGTCTGCCAGCGCCACACTGATGCCCAAGCACAGGCATCTGCA----------------
-N--A--L--S--L--R--Q--V--S--E--F--L--S--R--V--C--Q--R--H--T--D--A--Q--A--Q--A--S--A-----------------

--------------------------------------------------------------------------------------------------><
M--H--S--S--Q--A--S--D--N--P--F--S--P--P--R--T--L--H--S--P--P--L--Q--L--Q--Q--R--S--E--K--P--P--W--Y
TGCACAGCAGCCAGGCCTCAGATAACCCATTTTCTCCACCACGTACTCTTCATTCACCTCCCCTGCAACTCCAGCAGCGCTCTGAGAAGCCCCCTTGGTA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--S--S--G--P--S--S--T--V--S--S--A--G--P--S--S--P--T--T--V--D--G--N--S--Q--F--G--F--S--D--Q--P--S--L-
CAGCAGTGGCCCTTCTAGCACTGTGTCCAGTGCTGGTCCTTCTTCCCCTACTACAGTAGATGGTAACTCCCAATTTGGCTTCAGTGATCAACCCTCCCTA
 :::::::::::::::::::::::::::::::::::.:::::.:::::::::.::::.:::::.:::: ::: ::::::::::.:::::: :::::::::
-AGCAGTGGCCCTTCTAGCACTGTGTCCAGTGCTGGCCCTTCCTCCCCTACTGCAGTGGATGGCAACTGCCATTTTGGCTTCAATGATCACCCCTCCCTA
--S--S--G--P--S--S--T--V--S--S--A--G--P--S--S--P--T--A--V--D--G--N--C--H--F--G--F--N--D--H--P--S--L-

----------------------------------------------------------------------------------------------------
-N--S--H--V--A--E--E--H--Q--G--L--G--L--L--Q--E--T--P--G--S--G--A--Q--E--L--S--I--E--G--E--Q--E--L--
AATTCACACGTGGCTGAAGAACATCAAGGCCTTGGGCTGCTCCAGGAGACCCCTGGGAGTGGAGCACAAGAGCTCTCCATAGAAGGGGAGCAAGAGCTTT
:.::::::.:::..:::::::::.::::::.::::::::.:::::::::::::::::: ::::::::::::::::.:..:::::::::::: :::::.::
AGTTCACATGTGATTGAAGAACACCAAGGCTTTGGGCTGTTCCAGGAGACCCCTGGGACTGGAGCACAAGAGCTCCCTGTAGAAGGGGAGCCAGAGCCTT
-S--S--H--V--I--E--E--H--Q--G--F--G--L--F--Q--E--T--P--G--T--G--A--Q--E--L--P--V--E--G--E--P--E--P--

----------------------------------------------------------------------------------------------------
F--E--P--N--Q--S--P--Q--V--P--P--M--E--T--S--Q--P--Y--E--E--V--S--Q--P--C--Q--E--V--P--D--I--S--Q--P
TTGAACCAAATCAGTCCCCACAGGTGCCACCTATGGAAACCAGCCAGCCATACGAGGAGGTCAGCCAGCCATGTCAGGAGGTCCCTGACATCAGCCAGCC
:::::  :::.::::.:::::::: ..:::::.::::::::::::::::::.:::::::::.. : ::                  :: .::::::::::
TTGAAGGAAACCAGTTCCCACAGGAATCACCTGTGGAAACCAGCCAGCCATGCGAGGAGGTTGCCGAG------------------GAGGTCAGCCAGCC
F--E--G--N--Q--F--P--Q--E--S--P--V--E--T--S--Q--P--C--E--E--V--A--E--------------------E--V--S--Q--P

----------------------------------------------------------------------------------------------------
--C--Q--D--I--S--E--A--L--S--Q--P--C--Q--K--V--P--D--I--S--Q--Q--C--Q--E--N--H--D--N--G--N--H--T--C-
ATGCCAGGACATTTCTGAGGCGCTCAGCCAGCCATGTCAGAAGGTCCCTGACATCAGCCAGCAATGCCAGGAGAACCATGACAATGGTAACCACACATGC
::::::::::: ..::::.: : :.:::::::::                              ::: ::::::::.::::..::: :::::: ::::::
ATGCCAGGACAACCCTGAAGAGGTTAGCCAGCCA------------------------------TGCAAGGAGAACTATGATGATGTTAACCAGACATGC
--C--Q--D--N--P--E--E--V--S--Q--P--------------------------------C--K--E--N--Y--D--D--V--N--Q--T--C-

----------------------------------------------------------------------------------------------------
-Q--E--V--P--H--I--S--Q--P--C--Q--K--S--S--Q--L--C--Q--K--V--S--E--E--V--C--Q--L--C--L--E--N--S--E--
CAGGAGGTCCCTCACATCAGCCAGCCATGCCAGAAGTCCAGCCAACTGTGCCAGAAAGTCTCTGAGGAAGTTTGCCAGCTATGTCTGGAGAACTCCGAGG
::.::.:::::::: ::::::::::::::::::                                                                   
CAAGAAGTCCCTCAAATCAGCCAGCCATGCCAG-------------------------------------------------------------------
-Q--E--V--P--Q--I--S--Q--P--C--Q--------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
E--V--S--Q--P--C--Q--G--V--S--V--E--V--G--K--L--V--H--K--F--H--V--G--V--G--S--L--V--Q--E--T--L--V--E
AGGTCAGCCAGCCATGCCAGGGGGTCTCTGTGGAGGTTGGCAAGCTGGTCCATAAGTTCCATGTAGGGGTTGGTAGCTTGGTCCAGGAAACCCTTGTAGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--V--G--S--P--A--E--E--I--P--E--E--V--I--Q--P--Y--Q--E--F--S--V--E--V--G--R--L--A--Q--E--T--S--A--I-
AGTTGGCAGCCCAGCTGAAGAGATCCCTGAGGAGGTCATCCAGCCATACCAGGAGTTCTCTGTGGAGGTTGGCAGGCTGGCCCAGGAGACTTCTGCGATC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-N--L--L--S--Q--G--I--P--E--I--D--K--P--S--Q--E--F--P--E--E--I--D--L--Q--A--Q--E--V--P--E--E--I--N--
AATCTGTTATCTCAGGGCATCCCTGAGATTGATAAACCATCCCAAGAGTTCCCTGAGGAGATTGATCTGCAGGCCCAGGAGGTCCCTGAGGAGATAAATT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

->
*-
AG
  
--
--

Pig Consensus Sequence

>BGISUST0000885017
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
---------------------------------------------------TGTTATCTCAGGTACTCCCGAGGAGTGCTCTCCCCAGGCCGCCACGTTC
GAACTCGTCTCTATTTTACCAGTGAGAGCCACGTCCACTCCTTGCTCAGTGTCTTCCGATATGGGGGACTTCTTGATGAGACCAAGGATGCACAGTGGCA
GCGAGCTTTGGCTTATCTTAGTGCCATCTCAGAGCTCAACTACATGACCCAGATTGTCATCATGCTTTATGAGGACAACACACGG---------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-------------------------------------------------TTCGAAGGGTGTTCCATGGTACCTACCATTTACCCCCTGGAAACTCTGCAT
AATGCCCTTTCTCTGCGTCAAGTGAGTGAATTCTTGAGTAGAGTCTGCCAGCGCCACACTGATGCCCAAGCACAGGCATCTGCA----------------
----------------------------------------------------------------------------------------------------
-AGCAGTGGCCCTTCTAGCACTGTGTCCAGTGCTGGCCCTTCCTCCCCTACTGCAGTGGATGGCAACTGCCATTTTGGCTTCAATGATCACCCCTCCCTA
AGTTCACATGTGATTGAAGAACACCAAGGCTTTGGGCTGTTCCAGGAGACCCCTGGGACTGGAGCACAAGAGCTCCCTGTAGAAGGGGAGCCAGAGCCTT
TTGAAGGAAACCAGTTCCCACAGGAATCACCTGTGGAAACCAGCCAGCCATGCGAGGAGGTTGCCGAGGAGGTCAGCCAGCCATGCCAGGACAACCCTGA
AGAGGTTAGCCAGCCATGCAAGGAGAACTATGATGATGTTAACCAGACATGCCAAGAAGTCCCTCAAATCAGCCAGCCATGCCAG---------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
------------------------------------------------------


>BGISUSP0000885017
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-----------------CYLRYSRGVLSPGRHVRTRLYFTSESHVHSLLSVFRYGGLLDETKDAQWQRALAYLSAISELNYMTQIVIMLYEDNTR-----
----------------------------------------------------------------------------------------------------
-----------------------------------------------------------------------------------FEGCSMVPTIYPLETLH
NALSLRQVSEFLSRVCQRHTDAQAQASA---------------------------------------SSGPSSTVSSAGPSSPTAVDGNCHFGFNDHPSL
SSHVIEEHQGFGLFQETPGTGAQELPVEGEPEPFEGNQFPQESPVETSQPCEEVAEEVSQPCQDNPEEVSQPCKENYDDVNQTCQEVPQISQPCQ-----
----------------------------------------------------------------------------------------------------
------------------