Sequences
EST Library Info
ova1Ovary
Clusters
Oligos
SNPs

Gene ID ENSG00000168830 (click for geneview)
Transcript ID ENST00000305344(link to ensembl)
Symbol HTR1E
Localtion Chromosome:6:87704164:87783068:1 band: 6q15
Description 5-hydroxytryptamine 1E receptor (5-HT-1E) (Serotonin receptor 1E) (5- HT1E) (S31). [Source:Uniprot/SWISSPROT;Acc:P28566]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--N--I--T--N--C--T--T--E--A--S--M--A--I--R--P--K--T--I--T--E--K--M--L--I--C--M--T--L--V--V--I--T--
ATGAACATCACAAACTGTACCACAGAGGCCAGCATGGCTATAAGACCCAAGACCATCACTGAGAAGATGCTCATTTGCATGACTCTGGTGGTCATCACCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
T--L--T--T--L--L--N--L--A--V--I--M--A--I--G--T--T--K--K--L--H--Q--P--A--N--Y--L--I--C--S--L--A--V--T
CCCTCACCACGTTGCTGAACTTGGCTGTGATCATGGCTATTGGCACCACCAAGAAGCTCCACCAGCCTGCCAACTACCTAATCTGTTCTCTGGCCGTGAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--D--L--L--V--A--V--L--V--M--P--L--S--I--I--Y--I--V--M--D--R--W--K--L--G--Y--F--L--C--E--V--W--L--S-
GGACCTCCTGGTGGCAGTGCTCGTCATGCCCCTGAGCATCATCTACATTGTCATGGATCGCTGGAAGCTTGGGTACTTCCTCTGTGAGGTGTGGCTGAGT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-V--D--M--T--C--C--T--C--S--I--L--H--L--C--V--I--A--L--D--R--Y--W--A--I--T--N--A--I--E--Y--A--R--K--
GTGGACATGACCTGCTGCACCTGCTCCATCCTCCACCTCTGTGTCATTGCCCTGGACAGGTACTGGGCCATCACCAATGCTATTGAATACGCCAGGAAGA
                                                                     ::::::::::::::.::.::.::::::::::
---------------------------------------------------------------------ATCACCAATGCTATCGAGTATGCCAGGAAGA
----------------------------------------------------------------------I--T--N--A--I--E--Y--A--R--K--

----------------------------------------------------------------------------------------------------
R--T--A--K--R--A--A--L--M--I--L--T--V--W--T--I--S--I--F--I--S--M--P--P--L--F--W--R--S--H--R--R--L--S
GGACGGCCAAGAGGGCCGCGCTGATGATCCTTACCGTCTGGACCATCTCCATTTTCATCTCCATGCCCCCTCTGTTCTGGAGAAGCCACCGCCGCCTAAG
:::: ::::::::::::: .:::::::::::.::::::::::::::::::::.::::::::::::::.::::::::::::::.::::::::::. :: ::
GGACCGCCAAGAGGGCCGGACTGATGATCCTCACCGTCTGGACCATCTCCATCTTCATCTCCATGCCTCCTCTGTTCTGGAGGAGCCACCGCCAACTCAG
R--T--A--K--R--A--G--L--M--I--L--T--V--W--T--I--S--I--F--I--S--M--P--P--L--F--W--R--S--H--R--Q--L--S

----------------------------------------------------------------------------------------------------
--P--P--P--S--Q--C--T--I--Q--H--D--H--V--I--Y--T--I--Y--S--T--L--G--A--F--Y--I--P--L--T--L--I--L--I-
CCCTCCCCCTAGTCAGTGCACCATCCAGCACGACCATGTTATCTACACCATTTACTCCACGCTGGGTGCGTTTTATATCCCCTTGACTTTGATACTGATT
::: ::::: ::.::::::.::::.:::::::::::.::.:::::::::::.::::::::.:: :: ::.:::::.::::::::::::::::::::::::
CCCACCCCCAAGCCAGTGCGCCATTCAGCACGACCACGTCATCTACACCATCTACTCCACACTTGGGGCATTTTACATCCCCTTGACTTTGATACTGATT
--P--P--P--S--Q--C--A--I--Q--H--D--H--V--I--Y--T--I--Y--S--T--L--G--A--F--Y--I--P--L--T--L--I--L--I-

----------------------------------------------------------------------------------------------------
-L--Y--Y--R--I--Y--H--A--A--K--S--L--Y--Q--K--R--G--S--S--R--H--L--S--N--R--S--T--D--S--Q--N--S--F--
CTCTATTACCGGATTTACCACGCGGCCAAGAGCCTTTACCAGAAAAGGGGATCAAGTCGGCACTTAAGCAACAGAAGCACAGATAGCCAGAATTCTTTTG
::::::::::::::::::::.::.::::::::::: :::::::::::.::::::::. :::::::::::::::::::::::::::::::.::::: ::.:
CTCTATTACCGGATTTACCATGCAGCCAAGAGCCTGTACCAGAAAAGAGGATCAAGCAGGCACTTAAGCAACAGAAGCACAGATAGCCAAAATTCATTCG
-L--Y--Y--R--I--Y--H--A--A--K--S--L--Y--Q--K--R--G--S--S--R--H--L--S--N--R--S--T--D--S--Q--N--S--F--

----------------------------------------------------------------------------------------------------
A--S--C--K--L--T--Q--T--F--C--V--S--D--F--S--T--S--D--P--T--T--E--F--E--K--F--H--A--S--I--R--I--P--P
CAAGTTGTAAACTTACACAGACTTTCTGTGTGTCTGACTTCTCCACCTCAGACCCTACCACAGAGTTTGAAAAGTTCCATGCCTCCATCAGGATCCCCCC
::::::::::::: ::::::::.:::::::::::::::::::::::::::::::::::::::::.::::::::: ::::..::::::::::::::::.::
CAAGTTGTAAACTGACACAGACCTTCTGTGTGTCTGACTTCTCCACCTCAGACCCTACCACAGAATTTGAAAAGATCCACACCTCCATCAGGATCCCTCC
A--S--C--K--L--T--Q--T--F--C--V--S--D--F--S--T--S--D--P--T--T--E--F--E--K--I--H--T--S--I--R--I--P--P

----------------------------------------------------------------------------------------------------
--F--D--N--D--L--D--H--P--G--E--R--Q--Q--I--S--S--T--R--E--R--K--A--A--R--I--L--G--L--I--L--G--A--F-
CTTCGACAATGATCTAGATCACCCAGGAGAACGTCAGCAGATCTCTAGCACCAGGGAACGGAAGGCAGCACGCATCCTGGGGCTGATTCTGGGTGCATTC
.::.::::::::.::::::::::::::::::::.::::::::::::::.::::::::.:: :::::::: ::::::::::::::::::.:::::::.:::
TTTTGACAATGACCTAGATCACCCAGGAGAACGCCAGCAGATCTCTAGTACCAGGGAGCGCAAGGCAGCTCGCATCCTGGGGCTGATTTTGGGTGCGTTC
--F--D--N--D--L--D--H--P--G--E--R--Q--Q--I--S--S--T--R--E--R--K--A--A--R--I--L--G--L--I--L--G--A--F-

----------------------------------------------------------------------------------------------------
-I--L--S--W--L--P--F--F--I--K--E--L--I--V--G--L--S--I--Y--T--V--S--S--E--V--A--D--F--L--T--W--L--G--
ATTTTATCCTGGCTGCCATTTTTCATCAAAGAGTTGATTGTGGGTCTGAGCATCTACACCGTGTCCTCGGAAGTGGCCGACTTTCTGACGTGGCTCGGTT
::.::.:::::::::::::::::::::::::::.:::::::.::::::::::::::::::::.::::: ::::::::.::.:::.::::.::::::::::
ATCTTGTCCTGGCTGCCATTTTTCATCAAAGAGCTGATTGTAGGTCTGAGCATCTACACCGTATCCTCTGAAGTGGCTGATTTTTTGACATGGCTCGGTT
-I--L--S--W--L--P--F--F--I--K--E--L--I--V--G--L--S--I--Y--T--V--S--S--E--V--A--D--F--L--T--W--L--G--

------------------------------------------------------------------------------------------------->
Y--V--N--S--L--I--N--P--L--L--Y--T--S--F--N--E--D--F--K--L--A--F--K--K--L--I--R--C--R--E--H--T--*-
ATGTGAATTCTCTGATCAACCCTCTGCTCTATACGAGTTTTAATGAAGACTTTAAGCTGGCTTTTAAAAAGCTCATTAGATGCCGAGAGCATACTTAG
:::: ::::::::::::::::::::.:::::.::.::::::::::::                                                   
ATGTTAATTCTCTGATCAACCCTCTACTCTACACAAGTTTTAATGAA---------------------------------------------------
Y--V--N--S--L--I--N--P--L--L--Y--T--S--F--N--E----------------------------------------------------

Pig Consensus Sequence

>BGISUST0000899037
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
---------------------------------------------------------------------ATCACCAATGCTATCGAGTATGCCAGGAAGA
GGACCGCCAAGAGGGCCGGACTGATGATCCTCACCGTCTGGACCATCTCCATCTTCATCTCCATGCCTCCTCTGTTCTGGAGGAGCCACCGCCAACTCAG
CCCACCCCCAAGCCAGTGCGCCATTCAGCACGACCACGTCATCTACACCATCTACTCCACACTTGGGGCATTTTACATCCCCTTGACTTTGATACTGATT
CTCTATTACCGGATTTACCATGCAGCCAAGAGCCTGTACCAGAAAAGAGGATCAAGCAGGCACTTAAGCAACAGAAGCACAGATAGCCAAAATTCATTCG
CAAGTTGTAAACTGACACAGACCTTCTGTGTGTCTGACTTCTCCACCTCAGACCCTACCACAGAATTTGAAAAGATCCACACCTCCATCAGGATCCCTCC
TTTTGACAATGACCTAGATCACCCAGGAGAACGCCAGCAGATCTCTAGTACCAGGGAGCGCAAGGCAGCTCGCATCCTGGGGCTGATTTTGGGTGCGTTC
ATCTTGTCCTGGCTGCCATTTTTCATCAAAGAGCTGATTGTAGGTCTGAGCATCTACACCGTATCCTCTGAAGTGGCTGATTTTTTGACATGGCTCGGTT
ATGTTAATTCTCTGATCAACCCTCTACTCTACACAAGTTTTAATGAA------------------------------------------------


>BGISUSP0000899037
----------------------------------------------------------------------------------------------------
-----------------------ITNAIEYARKRTAKRAGLMILTVWTISIFISMPPLFWRSHRQLSPPPSQCAIQHDHVIYTIYSTLGAFYIPLTLILI
LYYRIYHAAKSLYQKRGSSRHLSNRSTDSQNSFASCKLTQTFCVSDFSTSDPTTEFEKIHTSIRIPPFDNDLDHPGERQQISSTRERKAARILGLILGAF
ILSWLPFFIKELIVGLSIYTVSSEVADFLTWLGYVNSLINPLLYTSFNE----------------