Sequences
EST Library Info
cki2Kidney - RNA from China
eye3Foetus 50 days, Eye
hea1Heart
nep1Newborn 115 days, epidermis
nmm1Newborn 115 days, mucosal membranes
pigcb1Unavailable
ssp3M. Supraspinatus
Clusters
Oligos
SNPs

Gene ID ENSG00000169217 (click for geneview)
Transcript ID ENST00000305596(link to ensembl)
Symbol CD2BP2
Localtion Chromosome:16:30271670:30274128:-1 band: 16p11.2
Description CD2 antigen cytoplasmic tail-binding protein 2 (CD2 cytoplasmic domain binding protein) (CD2 tail binding protein). [Source:Uniprot/SWISSPROT;Acc:O95400]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<----------------------------------------------------------------------------><---------------------
-M--P--K--R--K--V--T--F--Q--G--V--G--D--E--E--D--E--D--E--I--I--V--P--K--K--K--L--V--D--P--V--A--G--
ATGCCAAAGAGGAAAGTGACCTTCCAAGGCGTGGGAGATGAGGAGGATGAGGATGAAATCATTGTCCCCAAGAAGAAGCTGGTGGACCCTGTGGCTGGGT
::::.:::::::::::::::::::::::::::::::::.::::::::::::::::.::::: :::::::::::::      ::::::.::::::::::: 
ATGCTAAAGAGGAAAGTGACCTTCCAAGGCGTGGGAGACGAGGAGGATGAGGATGGAATCAGTGTCCCCAAGAAG------GTGGACTCTGTGGCTGGGG
-M--L--K--R--K--V--T--F--Q--G--V--G--D--E--E--D--E--D--G--I--S--V--P--K--K--------V--D--S--V--A--G--

----------------------------------------------------------------------------------------------------
S--G--G--P--G--S--R--F--K--G--K--H--S--L--D--S--D--E--E--E--D--D--D--D--G--G--S--S--K--Y--D--I--L--A
CAGGGGGTCCTGGGAGCCGCTTTAAAGGCAAACACTCTTTGGATAGCGATGAGGAGGAGGATGATGATGATGGGGGGTCCAGCAAATATGACATCTTGGC
.:::::::::::::::::::::.::::.:::::::::::::::.::::::::.::::: ::.:::::::::   ::::::::::::::::::::::::::
TAGGGGGTCCTGGGAGCCGCTTCAAAGACAAACACTCTTTGGACAGCGATGAAGAGGATGACGATGATGAT---GGGTCCAGCAAATATGACATCTTGGC
V--G--G--P--G--S--R--F--K--D--K--H--S--L--D--S--D--E--E--D--D--D--D--D-----G--S--S--K--Y--D--I--L--A

----------------><----------------------------------------------------------------------------------
--S--E--D--V--E--G--Q--E--A--A--T--L--P--S--E--G--G--V--R--I--T--P--F--N--L--Q--E--E--M--E--E--G--H-
CTCAGAGGATGTAGAAGGTCAGGAGGCAGCCACACTCCCCAGCGAGGGGGGTGTTCGGATCACACCCTTTAACCTGCAGGAGGAGATGGAGGAAGGCCAC
::::::::::::.:::   :::::.::.::::::::::::::.:::::.::::: :::::::::::.::.:::::::::::.::::::::::::::::::
CTCAGAGGATGTGGAA---CAGGAAGCGGCCACACTCCCCAGTGAGGGAGGTGTGCGGATCACACCTTTCAACCTGCAGGAAGAGATGGAGGAAGGCCAC
--S--E--D--V--E-----Q--E--A--A--T--L--P--S--E--G--G--V--R--I--T--P--F--N--L--Q--E--E--M--E--E--G--H-

--------------------------------------------------------------------------><------------------------
-F--D--A--D--G--N--Y--F--L--N--R--D--A--Q--I--R--D--S--W--L--D--N--I--D--W--V--K--I--R--E--R--P--P--
TTTGATGCCGATGGCAACTACTTCCTGAACCGGGATGCTCAGATCCGAGACAGCTGGCTGGACAACATTGACTGGGTGAAGATCCGGGAGCGGCCACCTG
::::::::.:::::::::::.::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: :::::::.:::::::
TTTGATGCTGATGGCAACTATTTCCTGAACCGGGATGCTCAGATCCGAGACAGCTGGCTGGACAACATTGACTGGGTGAAGATCAGGGAGCGACCACCTG
-F--D--A--D--G--N--Y--F--L--N--R--D--A--Q--I--R--D--S--W--L--D--N--I--D--W--V--K--I--R--E--R--P--P--

----------------------------------------------------------------------------------------------------
G--Q--R--Q--A--S--D--S--E--E--E--D--S--L--G--Q--T--S--M--S--A--Q--A--L--L--E--G--L--L--E--L--L--L--P
GCCAGCGCCAGGCCTCAGACTCGGAGGAGGAGGACAGCTTGGGCCAGACCTCAATGAGTGCCCAAGCCCTCTTGGAGGGACTTTTGGAGCTCCTATTGCC
..::::::: . . :::::::: ::::::::::::::..:::::::::: .:::::::.:.::::::::::.:.:::::.:::.::::::: ::.:::::
ATCAGCGCCCACTGTCAGACTCCGAGGAGGAGGACAGTCTGGGCCAGACACCAATGAGCGTCCAAGCCCTCCTAGAGGGGCTTCTGGAGCTGCTGTTGCC
D--Q--R--P--L--S--D--S--E--E--E--D--S--L--G--Q--T--P--M--S--V--Q--A--L--L--E--G--L--L--E--L--L--L--P

----------------------------------------------------------------------------------------------------
--R--E--T--V--A--G--A--L--R--R--L--G--A--R--G--G--G--K--G-----R--K--G--P--G--Q--P--S--S--P--Q--R--L-
TAGAGAGACAGTGGCTGGGGCACTGAGGCGTCTGGGGGCCCGAGGAGGAGGCAAAGGG---AGAAAGGGGCCTGGGCAACCCAGTTCCCCTCAGCGCCTG
.::::::::::::::::::::::::::::::::.::::::::::::::::::::::::   :: :::::::::::::..:::::::::::.:::::::::
CAGAGAGACAGTGGCTGGGGCACTGAGGCGTCTAGGGGCCCGAGGAGGAGGCAAAGGGGGCAGCAAGGGGCCTGGGCGGCCCAGTTCCCCCCAGCGCCTG
--R--E--T--V--A--G--A--L--R--R--L--G--A--R--G--G--G--K--G--G--S--K--G--P--G--R--P--S--S--P--Q--R--L-

----------------------------------------------------------------------------------------------------
-D--R--L--S--G--L--A--D--Q--M--V--A--R--G--N--L--G--V--Y--Q--E--T--R--E--R--L--A--M--R--L--K--G--L--
GACCGGCTCTCCGGGTTGGCCGACCAGATGGTGGCCCGGGGCAACCTTGGTGTGTACCAGGAAACAAGGGAACGGTTGGCTATGCGTCTGAAGGGTTTGG
::.:::::.::.::::::::.::::::::::::::::::::::::::.:: ::.::.:::::.:::::::::::..::::.:::::.:::::.:: ::::
GATCGGCTTTCTGGGTTGGCTGACCAGATGGTGGCCCGGGGCAACCTCGGAGTATATCAGGAGACAAGGGAACGACTGGCCATGCGCCTGAAAGGATTGG
-D--R--L--S--G--L--A--D--Q--M--V--A--R--G--N--L--G--V--Y--Q--E--T--R--E--R--L--A--M--R--L--K--G--L--

----------------------------------------------------------------------------------------------------
G--C--Q--T--L--G--P--H--N--P--T--P--P--P--S--L--D--M--F--A--E--E--L--A--E--E--E--L--E--T--P--T--P--T
GGTGTCAGACCCTAGGACCCCACAATCCCACACCCCCACCCTCCCTGGACATGTTCGCTGAGGAGTTGGCGGAGGAGGAACTGGAGACCCCAACCCCTAC
::::.:.::::: .::: ::: ..:.:::::::::::::: ::.:::::::::::.::::::::: ::::::::: :::.::::::::::::::::::.:
GGTGCCGGACCCAGGGAGCCCCTGACCCCACACCCCCACCGTCTCTGGACATGTTTGCTGAGGAGGTGGCGGAGGCGGAGCTGGAGACCCCAACCCCTGC
G--C--R--T--Q--G--A--P--D--P--T--P--P--P--S--L--D--M--F--A--E--E--V--A--E--A--E--L--E--T--P--T--P--A

----------><----------------------------------------------------------------------------------------
--Q--R--G--E--A--E--S--R--G--D--G--L--V--D--V--M--W--E--Y--K--W--E--N--T--G--D--A--E--L--Y--G--P--F-
CCAGAGAGGAGAAGCAGAGTCGCGGGGAGATGGTCTGGTGGATGTGATGTGGGAATATAAGTGGGAGAACACGGGGGATGCCGAGCTGTATGGGCCCTTC
:::::.:      ::::::::.:  :::::::::.:::.:::.:::::::::::::::::.::::::::::::::::::::.::::::::.:::::.:::
CCAGAAA------GCAGAGTCACCCGGAGATGGTTTGGCGGACGTGATGTGGGAATATAAATGGGAGAACACGGGGGATGCTGAGCTGTACGGGCCTTTC
--Q--K--------A--E--S--P--G--D--G--L--A--D--V--M--W--E--Y--K--W--E--N--T--G--D--A--E--L--Y--G--P--F-

-----------------><---------------------------------------------------------------------------------
-T--S--A--Q--M--Q--T--W--V--S--E--G--Y--F--P--D--G--V--Y--C--R--K--L--D--P--P--G--G--Q--F--Y--N--S--
ACCAGCGCCCAGATGCAGACCTGGGTGAGTGAAGGCTACTTCCCGGACGGTGTTTATTGCCGGAAGCTGGACCCCCCTGGTGGTCAGTTCTACAACTCCA
: ::::.:::::::::::::::::::::..::::::::::::::.::.:::::::::::::::::::: ::::::::.::.:: ::::::::::::::::
AGCAGCACCCAGATGCAGACCTGGGTGAACGAAGGCTACTTCCCAGATGGTGTTTATTGCCGGAAGCTCGACCCCCCCGGCGGACAGTTCTACAACTCCA
-S--S--T--Q--M--Q--T--W--V--N--E--G--Y--F--P--D--G--V--Y--C--R--K--L--D--P--P--G--G--Q--F--Y--N--S--

---------------------------->
K--R--I--D--F--D--L--Y--T--*-
AACGCATTGACTTTGACCTCTACACCTGA
:::: ::::::::::::::::::::::::
AACGGATTGACTTTGACCTCTACACCTGA
K--R--I--D--F--D--L--Y--T--*-

Pig Consensus Sequence

>BGISUST0000896720
ATGCTAAAGAGGAAAGTGACCTTCCAAGGCGTGGGAGACGAGGAGGATGAGGATGGAATCAGTGTCCCCAAGAAG------GTGGACTCTGTGGCTGGGG
TAGGGGGTCCTGGGAGCCGCTTCAAAGACAAACACTCTTTGGACAGCGATGAAGAGGATGACGATGATGATGGGTCCAGCAAATATGACATCTTGGCCTC
AGAGGATGTGGAA---CAGGAAGCGGCCACACTCCCCAGTGAGGGAGGTGTGCGGATCACACCTTTCAACCTGCAGGAAGAGATGGAGGAAGGCCACTTT
GATGCTGATGGCAACTATTTCCTGAACCGGGATGCTCAGATCCGAGACAGCTGGCTGGACAACATTGACTGGGTGAAGATCAGGGAGCGACCACCTGATC
AGCGCCCACTGTCAGACTCCGAGGAGGAGGACAGTCTGGGCCAGACACCAATGAGCGTCCAAGCCCTCCTAGAGGGGCTTCTGGAGCTGCTGTTGCCCAG
AGAGACAGTGGCTGGGGCACTGAGGCGTCTAGGGGCCCGAGGAGGAGGCAAAGGGGGCAGCAAGGGGCCTGGGCGGCCCAGTTCCCCCCAGCGCCTGGAT
CGGCTTTCTGGGTTGGCTGACCAGATGGTGGCCCGGGGCAACCTCGGAGTATATCAGGAGACAAGGGAACGACTGGCCATGCGCCTGAAAGGATTGGGGT
GCCGGACCCAGGGAGCCCCTGACCCCACACCCCCACCGTCTCTGGACATGTTTGCTGAGGAGGTGGCGGAGGCGGAGCTGGAGACCCCAACCCCTGCCCA
G------GCAGAGTCACCCGGAGATGGTTTGGCGGACGTGATGTGGGAATATAAATGGGAGAACACGGGGGATGCTGAGCTGTACGGGCCTTTCAGCAGC
ACCCAGATGCAGACCTGGGTGAACGAAGGCTACTTCCCAGATGGTGTTTATTGCCGGAAGCTCGACCCCCCCGGCGGACAGTTCTACAACTCCAAACGGA
TTGACTTTGACCTCTACACCTGA


>BGISUSP0000896720
MLKRKVTFQGVGDEEDEDGISVPKK--VDSVAGVGGPGSRFKDKHSLDSDEEDDDDDGSSKYDILASEDVE-QEAATLPSEGGVRITPFNLQEEMEEGHF
DADGNYFLNRDAQIRDSWLDNIDWVKIRERPPDQRPLSDSEEEDSLGQTPMSVQALLEGLLELLLPRETVAGALRRLGARGGGKGGSKGPGRPSSPQRLD
RLSGLADQMVARGNLGVYQETRERLAMRLKGLGCRTQGAPDPTPPPSLDMFAEEVAEAELETPTPAQ--AESPGDGLADVMWEYKWENTGDAELYGPFSS
TQMQTWVNEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT*