Sequences
EST Library Info
ebs2Foetus 50 days, brain stem
fbs1Unavailable
pigcb1Unavailable
tes1Testes
Clusters
Oligos
SNPs

Gene ID ENSG00000168806 (click for geneview)
Transcript ID ENST00000305641(link to ensembl)
Symbol LCMT2
Localtion Chromosome:15:41407919:41409979:-1 band: 15q15.3
Description Leucine carboxyl methyltransferase 2 (EC 2.1.1.-) (p21WAF1/CIP1 promoter-interacting protein).
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--G--P--R--S--R--E--R--R--A--G--A--V--Q--N--T--N--D--S--S--A--L--S--K--R--S--L--A--A--R--G--Y--V--
ATGGGCCCCCGGAGCCGTGAGCGTCGGGCAGGCGCGGTACAGAACACCAACGACAGCAGCGCCCTCAGCAAGCGTTCCCTGGCCGCGCGCGGGTACGTGC
:::::::: ::::::::.:::::::: ::.:: ::.::.::::..:::::.::::::::::::::::::::: :.:::::::::::::::::::::::::
ATGGGCCCGCGGAGCCGCGAGCGTCGCGCGGGAGCAGTGCAGAGTACCAATGACAGCAGCGCCCTCAGCAAGAGCTCCCTGGCCGCGCGCGGGTACGTGC
-M--G--P--R--S--R--E--R--R--A--G--A--V--Q--S--T--N--D--S--S--A--L--S--K--S--S--L--A--A--R--G--Y--V--

----------------------------------------------------------------------------------------------------
Q--D--P--F--A--A--L--L--V--P--G--A--A--R--R--A--P--L--I--H--R--G--Y--Y--V--R--A--R--A--V--R--H--C--V
AGGACCCCTTTGCCGCGTTGCTGGTTCCGGGCGCGGCGCGCCGCGCACCGCTCATTCACCGAGGCTACTACGTCCGCGCACGCGCCGTGAGGCACTGCGT
: ::: :::::::::: :::::.:::::::   : :.:::::::::.::::: ::.::::: ::::::::::::::::::::::::::: ::::::::::
ACGACACCTTTGCCGCCTTGCTAGTTCCGGCGTCCGTGCGCCGCGCGCCGCTGATCCACCGCGGCTACTACGTCCGCGCACGCGCCGTGCGGCACTGCGT
H--D--T--F--A--A--L--L--V--P--A--S--V--R--R--A--P--L--I--H--R--G--Y--Y--V--R--A--R--A--V--R--H--C--V

----------------------------------------------------------------------------------------------------
--R--A--F--L--E--Q--I--G--A--P--Q--A--A--L--R--A--Q--I--L--S--L--G--A--G--F--D--S--L--Y--F--R--L--K-
GCGCGCTTTTTTGGAGCAGATTGGCGCGCCCCAGGCCGCGCTTCGCGCGCAGATCTTGTCTCTCGGCGCTGGCTTCGACTCGCTCTATTTTCGCTTAAAA
..:::: ::..::::: .::.  ::::: :.:  : :::::..:.:.. ::::::.::::::: :::::.::::. :::::::: :::::::::.: :::
ATGCGCATTCCTGGAGGGGACGCGCGCGGCTCTCGGCGCGCCCCACATCCAGATCCTGTCTCTGGGCGCCGGCTCGGACTCGCTGTATTTTCGCCTTAAA
--C--A--F--L--E--G--T--R--A--A--L--G--A--P--H--I--Q--I--L--S--L--G--A--G--S--D--S--L--Y--F--R--L--K-

----------------------------------------------------------------------------------------------------
-T--A--G--R--L--A--R--A--A--V--W--E--V--D--F--P--D--V--A--R--R--K--A--E--R--I--G--E--T--P--E--L--C--
ACCGCGGGCCGCCTGGCCCGGGCTGCAGTCTGGGAGGTGGATTTTCCGGACGTGGCGCGGCGCAAAGCAGAAAGGATTGGAGAGACGCCAGAGCTGTGCG
.:.:::::::::::  :: :::::::::::::::::::::::::::::::::::::::::::::::::.:: :::::: :::: :::::.::.:::::::
GCTGCGGGCCGCCTCCCCGGGGCTGCAGTCTGGGAGGTGGATTTTCCGGACGTGGCGCGGCGCAAAGCGGACAGGATTCGAGATACGCCGGAACTGTGCG
-A--A--G--R--L--P--G--A--A--V--W--E--V--D--F--P--D--V--A--R--R--K--A--D--R--I--R--D--T--P--E--L--C--

----------------------------------------------------------------------------------------------------
A--L--T--G--P--F--E--R--G--E--P--A--S--A--L--C--F--E--S--A--D--Y--C--I--L--G--L--D--L--R--Q--L--Q--R
CGTTAACCGGGCCTTTCGAGAGGGGGGAGCCCGCGTCCGCGCTGTGCTTTGAGAGCGCAGACTACTGCATCCTGGGTCTGGACTTGCGGCAGCTCCAGCG
::::::::::::::::: .: : :::::  ::: ::: .::::.:::::.:::::: :.::::::.:::::::::: ::::::.:::::::: : :::::
CGTTAACCGGGCCTTTCCGGCGCGGGGACGCCGGGTCAACGCTATGCTTCGAGAGCTCGGACTACCGCATCCTGGGGCTGGACCTGCGGCAGGTGCAGCG
A--L--T--G--P--F--R--R--G--D--A--G--S--T--L--C--F--E--S--S--D--Y--R--I--L--G--L--D--L--R--Q--V--Q--R

----------------------------------------------------------------------------------------------------
--V--E--E--A--L--G--A--A--G--L--D--A--A--S--P--T--L--L--L--A--E--A--V--L--T--Y--L--E--P--E--S--A--A-
AGTGGAGGAGGCCCTGGGCGCCGCGGGGCTCGACGCAGCCTCACCCACTCTGCTCCTGGCCGAGGCGGTGCTGACCTACCTCGAGCCGGAGAGTGCCGCG
. ::::  :::: :::: ::::::::: :: :::::.::: :::: ::::::::::::::.::::: :::::::::::::::::::::.: :.:::::::
GTTGGACCAGGCACTGGCCGCCGCGGGCCTAGACGCGGCCGCACCGACTCTGCTCCTGGCTGAGGCCGTGCTGACCTACCTCGAGCCGAATAATGCCGCG
--L--D--Q--A--L--A--A--A--G--L--D--A--A--A--P--T--L--L--L--A--E--A--V--L--T--Y--L--E--P--N--N--A--A-

----------------------------------------------------------------------------------------------------
-A--L--I--A--W--A--A--Q--R--F--P--N--A--L--F--V--V--Y--E--Q--M--R--P--Q--D--A--F--G--Q--F--M--L--Q--
GCCCTCATCGCCTGGGCAGCCCAGCGTTTTCCTAATGCCCTTTTCGTGGTCTATGAGCAGATGAGGCCTCAAGACGCCTTTGGCCAGTTCATGCTGCAAC
::::::::::::::::: ::::::.:::::.::.:::: :::::.:: ::.::.:::::::::::::: :: ::::::::.::::::::::::: :::::
GCCCTCATCGCCTGGGCCGCCCAGTGTTTTTCTGATGCGCTTTTTGTCGTTTACGAGCAGATGAGGCCGCATGACGCCTTCGGCCAGTTCATGCAGCAAC
-A--L--I--A--W--A--A--Q--C--F--S--D--A--L--F--V--V--Y--E--Q--M--R--P--H--D--A--F--G--Q--F--M--Q--Q--

----------------------------------------------------------------------------------------------------
H--F--R--Q--L--N--S--P--L--H--G--L--E--R--F--P--D--V--E--A--Q--R--R--R--F--L--Q--A--G--W--T--A--C--G
ATTTTCGGCAGCTAAACTCCCCCCTGCATGGCCTGGAGCGTTTTCCTGACGTGGAGGCGCAGCGGCGCCGCTTCCTTCAAGCTGGCTGGACCGCCTGCGG
:::::::::::::.::.:: ::::::::::::::::: ::.::::::::::.:::::: ::::.::. :::::.::.::.::.::::::::.:::::: :
ATTTTCGGCAGCTGAATTCACCCCTGCATGGCCTGGACCGCTTTCCTGACGCGGAGGCCCAGCAGCAGCGCTTTCTCCAGGCCGGCTGGACTGCCTGCCG
H--F--R--Q--L--N--S--P--L--H--G--L--D--R--F--P--D--A--E--A--Q--Q--Q--R--F--L--Q--A--G--W--T--A--C--R

----------------------------------------------------------------------------------------------------
--A--V--D--M--N--E--F--Y--H--C--F--L--P--A--E--E--R--R--R--V--E--N--I--E--P--F--D--E--F--E--E--W--H-
TGCCGTGGACATGAATGAATTCTATCACTGCTTTCTTCCCGCAGAAGAACGCCGGCGGGTGGAAAATATTGAACCCTTTGACGAATTTGAGGAGTGGCAT
:::: :::::::::::::.::.::::.:...:::::.:::::::::::::::::::: ::.:::::: :::::::.::::::::.:::::::::::::::
TGCCTTGGACATGAATGAGTTTTATCGCCATTTTCTCCCCGCAGAAGAACGCCGGCGCGTAGAAAATCTTGAACCTTTTGACGAGTTTGAGGAGTGGCAT
--A--L--D--M--N--E--F--Y--R--H--F--L--P--A--E--E--R--R--R--V--E--N--L--E--P--F--D--E--F--E--E--W--H-

----------------------------------------------------------------------------------------------------
-L--K--C--A--H--Y--F--I--L--A--A--S--R--G--D--T--L--S--H--T--L--V--F--P--S--S--E--A--F--P--R--V--N--
CTGAAGTGCGCCCATTATTTCATTCTGGCAGCTTCTAGGGGAGACACCCTCTCCCACACCCTAGTGTTTCCATCCTCAGAGGCATTTCCTCGCGTAAATC
::::::::: ::::.:::::::::::::: :::::: :::::::::.. ::::::: ::. :::::::.::: : ::::::.:.:::::::: .::.:::
CTGAAGTGCTCCCACTATTTCATTCTGGCCGCTTCTCGGGGAGACATTGTCTCCCAAACTGTAGTGTTCCCAGCATCAGAGACGTTTCCTCGGATAGATC
-L--K--C--S--H--Y--F--I--L--A--A--S--R--G--D--I--V--S--Q--T--V--V--F--P--A--S--E--T--F--P--R--I--D--

----------------------------------------------------------------------------------------------------
P--A--S--P--S--G--V--F--P--A--S--V--V--S--S--E--G--Q--V--P--N--L--K--R--Y--G--H--A--S--V--F--L--S--P
CTGCTTCGCCTTCAGGGGTATTCCCTGCCAGCGTAGTCAGTAGCGAGGGCCAGGTCCCAAACCTGAAGAGATATGGCCACGCCTCTGTCTTCTTGAGCCC
::::.:: ::::: ::.::  :::::::. :.::::::: :::.:: .:::::: .:::.:::: ::::::::::::::.:::::::::.:.::::::::
CTGCCTCCCCTTCCGGAGTCATCCCTGCTCGTGTAGTCACTAGTGATAGCCAGGGTCCAGACCTTAAGAGATATGGCCATGCCTCTGTCCTTTTGAGCCC
P--A--S--P--S--G--V--I--P--A--R--V--V--T--S--D--S--Q--G--P--D--L--K--R--Y--G--H--A--S--V--L--L--S--P

----------------------------------------------------------------------------------------------------
--D--V--I--L--S--A--G--G--F--G--E--Q--E--G--R--H--C--R--V--S--Q--F--H--L--L--S--R--D--C--D--S--E--W-
AGACGTTATTCTCAGTGCAGGAGGATTTGGAGAGCAGGAGGGGCGGCACTGCCGAGTGAGCCAGTTTCACTTGCTCTCAAGAGATTGTGACTCTGAATGG
::::::::::::.:::::::::::.::::::::. :::::::::::::::::::::::::: :::::::::::::::::::: :.:::::::.:::::::
AGACGTTATTCTTAGTGCAGGAGGGTTTGGAGAAGAGGAGGGGCGGCACTGCCGAGTGAGCAAGTTTCACTTGCTCTCAAGATACTGTGACTTTGAATGG
--D--V--I--L--S--A--G--G--F--G--E--E--E--G--R--H--C--R--V--S--K--F--H--L--L--S--R--Y--C--D--F--E--W-

----------------------------------------------------------------------------------------------------
-K--G--S--Q--I--G--S--C--G--T--G--V--Q--W--D--G--R--L--Y--H--T--M--T--R--L--S--E--S--R--V--L--V--L--
AAAGGCAGCCAAATAGGCAGTTGTGGGACTGGAGTTCAGTGGGATGGACGCCTTTATCACACCATGACAAGACTCTCAGAGAGTCGGGTTCTGGTTCTGG
:::::::..:::.:: :.::::: ::.:::::::.::::::::::.::::::::::::::::::::::::::::.::::: : ::.::::::::::::::
AAAGGCAATCAAGTATGTAGTTGGGGAACTGGAGCTCAGTGGGATAGACGCCTTTATCACACCATGACAAGACTTTCAGATACTCAGGTTCTGGTTCTGG
-K--G--N--Q--V--C--S--W--G--T--G--A--Q--W--D--R--R--L--Y--H--T--M--T--R--L--S--D--T--Q--V--L--V--L--

----------------------------------------------------------------------------------------------------
G--G--R--L--S--P--V--S--P--A--L--G--V--L--Q--L--H--F--F--K--S--E--D--N--N--T--E--D--L--K--V--T--I--T
GAGGGAGACTGTCCCCAGTAAGTCCAGCCTTGGGGGTTCTCCAGCTTCATTTTTTTAAGAGTGAGGATAATAACACTGAGGACCTGAAAGTGACAATAAC
::::::::.::::::: :::: ::: :::::::::.:::::::::: ::::::   ::. .:: ::.:..::: :::::::.:::.:: .: :::.: ::
GAGGGAGATTGTCCCCTGTAACTCCCGCCTTGGGGATTCTCCAGCTACATTTTGGGAAACATGTGGGTGGTAAAACTGAGGGCCTAAATATCACAGTCAC
G--G--R--L--S--P--V--T--P--A--L--G--I--L--Q--L--H--F--G--K--H--V--G--G--K--T--E--G--L--N--I--T--V--T

----------------------------------------------------------------------------------------------------
--K--A--G--R--K--D--D--S--T--L--C--C--W--R--H--S--T--T--E--V--S--C--Q--N--Q--E--Y--L--F--V--Y--G--G-
AAAGGCTGGCCGAAAGGATGATTCCACTTTGTGTTGTTGGCGGCATTCAACAACAGAAGTGTCCTGTCAGAATCAGGAATATTTGTTTGTGTATGGGGGT
:::::. :::     .:: ::::::::  :::  ::.::::: ::::::::::::::::::::::.: ::::::::.::::::::::::::: ::::::.
AAAGGTGGGC---CCAGAAGATTCCACAGTGTCATGCTGGCGCCATTCAACAACAGAAGTGTCCTATAAGAATCAGAAATATTTGTTTGTGTTTGGGGGC
--K--V--G-----P--E--D--S--T--V--S--C--W--R--H--S--T--T--E--V--S--Y--K--N--Q--K--Y--L--F--V--F--G--G-

----------------------------------------------------------------------------------------------------
-R--S--V--V--E--P--V--L--S--D--W--H--F--L--H--V--G--T--M--A--W--V--R--I--P--V--E--G--E--V--P--E--A--
CGAAGCGTGGTGGAACCTGTACTAAGTGACTGGCATTTCCTCCATGTAGGGACAATGGCTTGGGTCAGGATCCCAGTGGAGGGAGAAGTACCTGAAGCCC
:: .:.::::..:: :::::::::::::::::::::::::: :::::.::::::::::::::::::::::::::::::::::::::::. ::.:::: .:
CGTGGTGTGGCAGACCCTGTACTAAGTGACTGGCATTTCCTACATGTGGGGACAATGGCTTGGGTCAGGATCCCAGTGGAGGGAGAAGCCCCCGAAGGTC
-R--G--V--A--D--P--V--L--S--D--W--H--F--L--H--V--G--T--M--A--W--V--R--I--P--V--E--G--E--A--P--E--G--

----------------------------------------------------------------------------------------------------
R--H--S--H--S--A--C--T--W--Q--G--G--A--L--I--A--G--G--L--G--A--S--E--E--P--L--N--S--V--L--F--L--R--P
GGCATTCTCACAGTGCCTGCACTTGGCAAGGGGGAGCCCTTATTGCTGGAGGTCTCGGGGCTTCTGAGGAGCCATTGAACTCTGTGCTCTTTCTGAGACC
:::::::.::::::::::::: .::::::::::::::.::.:::::::::::::: :: :::::::::::.::..:::.::::.:.::.:::::::.:::
GGCATTCCCACAGTGCCTGCAGCTGGCAAGGGGGAGCTCTCATTGCTGGAGGTCTGGGTGCTTCTGAGGAACCGCTGAGCTCTATACTTTTTCTGAAACC
R--H--S--H--S--A--C--S--W--Q--G--G--A--L--I--A--G--G--L--G--A--S--E--E--P--L--S--S--I--L--F--L--K--P

----------------------------------------------------------------------------------------------------
--I--S--C--G--F--L--W--E--S--V--D--I--Q--P--P--I--T--P--R--Y--S--H--T--A--H--V--L--N--G--K--L--L--L-
AATCTCTTGTGGATTCCTCTGGGAGTCAGTAGACATCCAGCCTCCCATTACCCCAAGGTACTCCCACACAGCTCATGTGCTCAATGGAAAGCTGTTACTG
:::::::: :::::::::::::::..::.::: :::.::::::::..:::::::::::::::::::::::::::::::: : ::::::::::: .:..::
AATCTCTTCTGGATTCCTCTGGGAACCAATAGCCATTCAGCCTCCTGTTACCCCAAGGTACTCCCACACAGCTCATGTGGTAAATGGAAAGCTTCTGTTG
--I--S--S--G--F--L--W--E--P--I--A--I--Q--P--P--V--T--P--R--Y--S--H--T--A--H--V--V--N--G--K--L--L--L-

----------------------------------------------------------------------------------------------------
-V--G--G--I--W--I--H--S--S--S--F--P--G--V--T--V--I--N--L--T--T--G--L--S--S--E--Y--Q--I--D--T--T--Y--
GTTGGAGGGATCTGGATTCATTCCTCCTCATTTCCTGGAGTGACTGTGATCAATTTGACTACAGGATTGAGCTCTGAGTATCAGATTGACACAACATATG
:::::::::.:::::::::.:::::::::: :::::::::::::::: ::..::::: :::: :::::::::::::::::::::::::::::::.: :::
GTTGGAGGGGTCTGGATTCGTTCCTCCTCAGTTCCTGGAGTGACTGTTATTGATTTGTCTACCGGATTGAGCTCTGAGTATCAGATTGACACAATAGATG
-V--G--G--V--W--I--R--S--S--S--V--P--G--V--T--V--I--D--L--S--T--G--L--S--S--E--Y--Q--I--D--T--I--D--

----------------------------------------------------------------------------------------------------
V--P--W--P--L--M--L--H--N--H--T--S--I--L--L--P--E--E--Q--Q--L--L--L--L--G--G--G--G--N--C--F--S--F--G
TGCCATGGCCATTAATGTTACACAACCATACTAGTATCCTTCTTCCTGAAGAGCAACAGCTCCTGCTCCTTGGAGGTGGTGGGAACTGCTTTTCCTTTGG
:::::::::::::::::::::::::::::::.::.:::::.:::::::::::.:::::::::::: :: :::::::::::::.:::::::::::::::::
TGCCATGGCCATTAATGTTACACAACCATACCAGCATCCTCCTTCCTGAAGAACAACAGCTCCTGATCATTGGAGGTGGTGGAAACTGCTTTTCCTTTGG
V--P--W--P--L--M--L--H--N--H--T--S--I--L--L--P--E--E--Q--Q--L--L--I--I--G--G--G--G--N--C--F--S--F--G

------------------------------------------------------------>
--T--Y--F--N--P--H--T--V--T--L--D--L--S--S--L--S--A--G--Q--*-
TACCTACTTCAACCCCCATACAGTCACATTAGACCTTTCTTCCTTAAGTGCTGGGCAGTAA
.::::::::::::::::::.:::: :::::::::::::::::::::::::::.:.::.:.:
CACCTACTTCAACCCCCATGCAGTGACATTAGACCTTTCTTCCTTAAGTGCTAGACAATGA
--T--Y--F--N--P--H--A--V--T--L--D--L--S--S--L--S--A--R--Q--*-

Pig Consensus Sequence

>BGISUST0000878880
ATGGGCCCGCGGAGCCGCGAGCGTCGCGCGGGAGCAGTGCAGAGTACCAATGACAGCAGCGCCCTCAGCAAGAGCTCCCTGGCCGCGCGCGGGTACGTGC
ACGACACCTTTGCCGCCTTGCTAGTTCCGGCGTCCGTGCGCCGCGCGCCGCTGATCCACCGCGGCTACTACGTCCGCGCACGCGCCGTGCGGCACTGCGT
ATGCGCATTCCTGGAGGGGACGCGCGCGGCTCTCGGCGCGCCCCACATCCAGATCCTGTCTCTGGGCGCCGGCTCGGACTCGCTGTATTTTCGCCTTAAA
GCTGCGGGCCGCCTCCCCGGGGCTGCAGTCTGGGAGGTGGATTTTCCGGACGTGGCGCGGCGCAAAGCGGACAGGATTCGAGATACGCCGGAACTGTGCG
CGTTAACCGGGCCTTTCCGGCGCGGGGACGCCGGGTCAACGCTATGCTTCGAGAGCTCGGACTACCGCATCCTGGGGCTGGACCTGCGGCAGGTGCAGCG
GTTGGACCAGGCACTGGCCGCCGCGGGCCTAGACGCGGCCGCACCGACTCTGCTCCTGGCTGAGGCCGTGCTGACCTACCTCGAGCCGAATAATGCCGCG
GCCCTCATCGCCTGGGCCGCCCAGTGTTTTTCTGATGCGCTTTTTGTCGTTTACGAGCAGATGAGGCCGCATGACGCCTTCGGCCAGTTCATGCAGCAAC
ATTTTCGGCAGCTGAATTCACCCCTGCATGGCCTGGACCGCTTTCCTGACGCGGAGGCCCAGCAGCAGCGCTTTCTCCAGGCCGGCTGGACTGCCTGCCG
TGCCTTGGACATGAATGAGTTTTATCGCCATTTTCTCCCCGCAGAAGAACGCCGGCGCGTAGAAAATCTTGAACCTTTTGACGAGTTTGAGGAGTGGCAT
CTGAAGTGCTCCCACTATTTCATTCTGGCCGCTTCTCGGGGAGACATTGTCTCCCAAACTGTAGTGTTCCCAGCATCAGAGACGTTTCCTCGGATAGATC
CTGCCTCCCCTTCCGGAGTCATCCCTGCTCGTGTAGTCACTAGTGATAGCCAGGGTCCAGACCTTAAGAGATATGGCCATGCCTCTGTCCTTTTGAGCCC
AGACGTTATTCTTAGTGCAGGAGGGTTTGGAGAAGAGGAGGGGCGGCACTGCCGAGTGAGCAAGTTTCACTTGCTCTCAAGATACTGTGACTTTGAATGG
AAAGGCAATCAAGTATGTAGTTGGGGAACTGGAGCTCAGTGGGATAGACGCCTTTATCACACCATGACAAGACTTTCAGATACTCAGGTTCTGGTTCTGG
GAGGGAGATTGTCCCCTGTAACTCCCGCCTTGGGGATTCTCCAGCTACATTTTGGGAAACATGTGGGTGGTAAAACTGAGGGCCTAAATATCACAGTCAC
AAAGGTGGGCCCAGAAGATTCCACAGTGTCATGCTGGCGCCATTCAACAACAGAAGTGTCCTATAAGAATCAGAAATATTTGTTTGTGTTTGGGGGCCGT
GGTGTGGCAGACCCTGTACTAAGTGACTGGCATTTCCTACATGTGGGGACAATGGCTTGGGTCAGGATCCCAGTGGAGGGAGAAGCCCCCGAAGGTCGGC
ATTCCCACAGTGCCTGCAGCTGGCAAGGGGGAGCTCTCATTGCTGGAGGTCTGGGTGCTTCTGAGGAACCGCTGAGCTCTATACTTTTTCTGAAACCAAT
CTCTTCTGGATTCCTCTGGGAACCAATAGCCATTCAGCCTCCTGTTACCCCAAGGTACTCCCACACAGCTCATGTGGTAAATGGAAAGCTTCTGTTGGTT
GGAGGGGTCTGGATTCGTTCCTCCTCAGTTCCTGGAGTGACTGTTATTGATTTGTCTACCGGATTGAGCTCTGAGTATCAGATTGACACAATAGATGTGC
CATGGCCATTAATGTTACACAACCATACCAGCATCCTCCTTCCTGAAGAACAACAGCTCCTGATCATTGGAGGTGGTGGAAACTGCTTTTCCTTTGGCAC
CTACTTCAACCCCCATGCAGTGACATTAGACCTTTCTTCCTTAAGTGCTAGACAATGA


>BGISUSP0000878880
MGPRSRERRAGAVQSTNDSSALSKSSLAARGYVHDTFAALLVPASVRRAPLIHRGYYVRARAVRHCVCAFLEGTRAALGAPHIQILSLGAGSDSLYFRLK
AAGRLPGAAVWEVDFPDVARRKADRIRDTPELCALTGPFRRGDAGSTLCFESSDYRILGLDLRQVQRLDQALAAAGLDAAAPTLLLAEAVLTYLEPNNAA
ALIAWAAQCFSDALFVVYEQMRPHDAFGQFMQQHFRQLNSPLHGLDRFPDAEAQQQRFLQAGWTACRALDMNEFYRHFLPAEERRRVENLEPFDEFEEWH
LKCSHYFILAASRGDIVSQTVVFPASETFPRIDPASPSGVIPARVVTSDSQGPDLKRYGHASVLLSPDVILSAGGFGEEEGRHCRVSKFHLLSRYCDFEW
KGNQVCSWGTGAQWDRRLYHTMTRLSDTQVLVLGGRLSPVTPALGILQLHFGKHVGGKTEGLNITVTKVGPEDSTVSCWRHSTTEVSYKNQKYLFVFGGR
GVADPVLSDWHFLHVGTMAWVRIPVEGEAPEGRHSHSACSWQGGALIAGGLGASEEPLSSILFLKPISSGFLWEPIAIQPPVTPRYSHTAHVVNGKLLLV
GGVWIRSSSVPGVTVIDLSTGLSSEYQIDTIDVPWPLMLHNHTSILLPEEQQLLIIGGGGNCFSFGTYFNPHAVTLDLSSLSARQ*