Sequences
EST Library Info
cad1Unavailable
cbe1Cerebellum
cga1Galactophore - RNA from China
che1Heart - RNA from China
cje5Jejunum - RNA from China
cki6Kidney - RNA from China
cly1Lymph - RNA from China
cmu1Rhinal mucous membrane - RNA from China
csk1Skin - RNA from China
csp2Spleen - RNA from China
cst1Stomach - RNA from China
cte1Testicle - RNA from China
cut7Uterus - RNA from China
eep1Foetus 50 days, epidermis
ese1Foetus 50 days, M. semitendinosus
fcc1Unavailable
fhi1Unavailable
hea1Heart
hyp1Hypothalamus
jca1Joint capsule
jej1Small intestine, jejunum
mcp1Mammae, collostrum producing
plac3Unavailable
pldo1Unavailable
sme1M. Semimembranosus
ste1M. Semitendinosus
thg1Thyroid gland
ton1Tip of tongue, mucosal membrane
Clusters
Oligos
SNPs

Gene ID ENSG00000169976 (click for geneview)
Transcript ID ENST00000305692(link to ensembl)
Symbol SF3B5
Localtion Chromosome:6:144458067:144458327:-1 band: 6q24.2
Description Splicing factor 3B subunit 5 (SF3b5) (Pre-mRNA splicing factor SF3b 10 kDa subunit). [Source:Uniprot/SWISSPROT;Acc:Q9BWJ5]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--T--D--R--Y--T--I--H--S--Q--L--E--H--L--Q--S--K--Y--I--G--T--G--H--A--D--T--T--K--W--E--W--L--V--
ATGACTGACCGCTACACCATCCATAGCCAGCTGGAGCACCTGCAGTCCAAGTACATCGGCACGGGCCACGCCGACACCACCAAGTGGGAGTGGCTGGTGA
::::: :::::::::::::::::.::::::.:.:::::::::::::::::.::::::::::: ::::::::::::::::::::.::::::::::::::::
ATGACAGACCGCTACACCATCCACAGCCAGTTAGAGCACCTGCAGTCCAAATACATCGGCACCGGCCACGCCGACACCACCAAATGGGAGTGGCTGGTGA
-M--T--D--R--Y--T--I--H--S--Q--L--E--H--L--Q--S--K--Y--I--G--T--G--H--A--D--T--T--K--W--E--W--L--V--

----------------------------------------------------------------------------------------------------
N--Q--H--R--D--S--Y--C--S--Y--M--G--H--F--D--L--L--N--Y--F--A--I--A--E--N--E--S--K--A--R--V--R--F--N
ACCAACACCGCGACTCGTACTGCTCCTACATGGGCCACTTCGACCTTCTCAACTACTTCGCCATTGCGGAGAATGAGAGCAAAGCGCGAGTCCGCTTCAA
::::.::::::::::: ::.::::::::::::::::::::::::::::::::::::::.:::::::: ::::::::::::::::::::::::::::::::
ACCAGCACCGCGACTCCTATTGCTCCTACATGGGCCACTTCGACCTTCTCAACTACTTTGCCATTGCCGAGAATGAGAGCAAAGCGCGAGTCCGCTTCAA
N--Q--H--R--D--S--Y--C--S--Y--M--G--H--F--D--L--L--N--Y--F--A--I--A--E--N--E--S--K--A--R--V--R--F--N

------------------------------------------------------------>
--L--M--E--K--M--L--Q--P--C--G--P--P--A--D--K--P--E--E--N--*-
CTTGATGGAAAAGATGCTTCAGCCTTGTGGACCGCCAGCCGACAAGCCCGAGGAGAACTGA
:::::::::.:::::::: ::::::::.:: ::::: ::::::::.:: ::::::::::::
CTTGATGGAGAAGATGCTGCAGCCTTGCGGCCCGCCCGCCGACAAACCGGAGGAGAACTGA
--L--M--E--K--M--L--Q--P--C--G--P--P--A--D--K--P--E--E--N--*-

Pig Consensus Sequence

>BGISUST0000896935
ATGACAGACCGCTACACCATCCACAGCCAGTTAGAGCACCTGCAGTCCAAATACATCGGCACCGGCCACGCCGACACCACCAAATGGGAGTGGCTGGTGA
ACCAGCACCGCGACTCCTATTGCTCCTACATGGGCCACTTCGACCTTCTCAACTACTTTGCCATTGCCGAGAATGAGAGCAAAGCGCGAGTCCGCTTCAA
CTTGATGGAGAAGATGCTGCAGCCTTGCGGCCCGCCCGCCGACAAACCGGAGGAGAACTGA


>BGISUSP0000896935
MTDRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLLNYFAIAENESKARVRFNLMEKMLQPCGPPADKPEEN*