Sequences
EST Library Info
nlu4Newborn 115 days, lung
pigcb2Unavailable
plac2Unavailable
uio2Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000112419 (click for geneview)
Transcript ID ENST00000305766(link to ensembl)
Symbol PHACTR2
Localtion Chromosome:6:144074839:144186519:1 band: 6q24.2
Description Phosphatase and actin regulator 2. [Source:Uniprot/SWISSPROT;Acc:O75167]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-Y--T--V--D--G--L--D--K--A--S--I--A--N--S--D--G--P--T--A--G--S--Q--T--P--P--F--K--R--K--G--K--L--S--
TATACAGTTGACGGACTGGACAAAGCTTCTATAGCAAACTCAGATGGCCCCACAGCAGGTTCCCAAACACCTCCCTTCAAAAGAAAGGGGAAACTATCCA
      :::::.:::::::::::::::::::::::::::::::::::::: :::::::::::::::::::::::::::::.:::::::::::.:: ::::
------GTTGATGGACTGGACAAAGCTTCTATAGCAAACTCAGATGGCCCAACAGCAGGTTCCCAAACACCTCCCTTCAAGAGAAAGGGGAAGCTCTCCA
-------V--D--G--L--D--K--A--S--I--A--N--S--D--G--P--T--A--G--S--Q--T--P--P--F--K--R--K--G--K--L--S--

--------------------------------------------------------------------------><------------------------
T--I--G--K--I--F--K--P--W--K--W--R--K--K--K--T--S--D--K--F--R--E--T--S--A--V--L--E--R--K--I--S--T--R
CCATTGGTAAAATCTTTAAGCCTTGGAAATGGAGGAAAAAGAAGACCAGCGACAAATTTAGAGAAACCTCGGCAGTATTAGAAAGGAAGATATCCACACG
::::.::::::::::::::::::::::::::::::::::::::::::::.::::::::::::::::: ::.:::   :::::::::::::: :::::: :
CCATCGGTAAAATCTTTAAGCCTTGGAAATGGAGGAAAAAGAAGACCAGTGACAAATTTAGAGAAACATCAGCA---TTAGAAAGGAAGATTTCCACAAG
T--I--G--K--I--F--K--P--W--K--W--R--K--K--K--T--S--D--K--F--R--E--T--S--A-----L--E--R--K--I--S--T--R

-------------------------------------------------------><-------------------------------------------
--Q--S--R--E--E--L--I--R--R--G--V--L--K--E--L--P--D--Q--D--G--D--V--T--V--N--F--E--N--S--N--G--H--M-
ACAAAGTAGAGAGGAGCTGATAAGAAGGGGAGTGCTTAAGGAATTGCCTGATCAAGATGGAGATGTAACAGTTAACTTTGAAAATTCAAACGGGCACATG
::::::::::::::::::::::::::::::::: :::::::::::::::::::::   ::::::::::::::::::::::::::::::::::::::::::
ACAAAGTAGAGAGGAGCTGATAAGAAGGGGAGTTCTTAAGGAATTGCCTGATCAA---GGAGATGTAACAGTTAACTTTGAAAATTCAAACGGGCACATG
--Q--S--R--E--E--L--I--R--R--G--V--L--K--E--L--P--D--Q-----G--D--V--T--V--N--F--E--N--S--N--G--H--M-

----------------------------------------------------------------------------------------------------
----I--P--I--G--E--E--S--T--R--E--E--N--V--V--K--S--E--E--G--N--G--S--V--S--E--K--T--P--P--L--E--E--
---ATACCCATCGGAGAGGAATCTACCCGAGAGGAAAATGTAGTAAAGTCTGAAGAAGGTAATGGCTCTGTATCTGAAAAAACACCACCTCTGGAGGAAC
   :::::::::::::::::.::::::::::::::::::.:::::::. :::::::::: :::::::::::: ::::::::.::::::::::::::::: 
A--ATACCCATCGGAGAGGAGTCTACCCGAGAGGAAAATATAGTAAAAACTGAAGAAGGGAATGGCTCTGTAGCTGAAAAAGCACCACCTCTGGAGGAAA
-\--I--P--I--G--E--E--S--T--R--E--E--N--I--V--K--T--E--E--G--N--G--S--V--A--E--K--A--P--P--L--E--E--

-----------------><---------------------------------------------------------------------------------
Q--A--E--D--K--K--E--N--T--E--N--H--S--E--T--P--A--A--P--A--L--P--P--S--A--P--P--K--P--R--P--K--P--K
AGGCAGAAGATAAGAAAGAGAACACTGAAAACCACTCTGAAACACCGGCAGCTCCTGCTCTACCTCCTTCTGCTCCTCCTAAGCCTAGACCCAAACCTAA
:::::::::::::::::   ::::::::::::::::.::::::::::::::::::::.::.:::::::.: ::::.:: ::::: ::.::::::::.:::
AGGCAGAAGATAAGAAA---AACACTGAAAACCACTTTGAAACACCGGCAGCTCCTGTTCCACCTCCTCCAGCTCTTCATAAGCATAAACCCAAACTTAA
K--A--E--D--K--K-----N--T--E--N--H--F--E--T--P--A--A--P--V--P--P--P--P--A--L--H--K--H--K--P--K--L--K

----------------------------------------------------------------------------------------------------
--P--K--K--S--P--V--P--P--K--G--A--T--A--G--A--S--H--K--G--D--E--V--P--P--I--K--K--N--T--K--A--P--G-
ACCCAAAAAATCACCTGTGCCTCCGAAAGGGGCCACTGCTGGGGCCAGCCACAAAGGTGATGAAGTGCCTCCCATTAAAAAAAATACCAAGGCTCCTGGT
:::::::::: :::::::::::::.:::::::::.::::.:::::::::: :::.:::::::::::::::::.::::::::::::::::::.::::::::
ACCCAAAAAAACACCTGTGCCTCCAAAAGGGGCCGCTGCCGGGGCCAGCCCCAAGGGTGATGAAGTGCCTCCTATTAAAAAAAATACCAAGACTCCTGGT
--P--K--K--T--P--V--P--P--K--G--A--A--A--G--A--S--P--K--G--D--E--V--P--P--I--K--K--N--T--K--T--P--G-

---------------------------------------------------------><-----------------------------------------
-K--Q--A--P--V--P--P--P--K--P--A--S--R--N--T--T--R--E--A--A--G--S--S--H--S--K--K--T--T--G--S--K--A--
AAGCAGGCCCCCGTCCCTCCACCCAAGCCAGCAAGCCGAAACACGACCCGAGAGGCTGCTGGCTCCTCTCATTCAAAAAAAACAACTGGCTCTAAAGCA-
:::::::.:::.:::::::.::::::::::.::::::::::..: ::::::::::::   ::.:::::::::::::.:::::::::::::::::::::: 
AAGCAGGTCCCTGTCCCTCTACCCAAGCCAACAAGCCGAAATGCTACCCGAGAGGCT---GGTTCCTCTCATTCAAGAAAAACAACTGGCTCTAAAGCAT
-K--Q--V--P--V--P--L--P--K--P--T--S--R--N--A--T--R--E--A-----G--S--S--H--S--R--K--T--T--G--S--K--A--

----------------------------------------------------------------------------------------------------
---S--A--S--P--S--T--S--S--T--S--S--R--P--K--A--S--K--E--T--V--S--S--K--A--G--T--V--G--T--T--K--G--K
--TCAGCTTCGCCATCCACTTCATCCACCTCATCTCGTCCCAAAGCTTCAAAGGAGACAGTTTCTAGCAAAGCAGGGACAGTGGGGACCACCAAGGGCAA
   :::::::.::.::.::::: :::::::::::::::.::::::::::::::::::: ::::::::::::.:.:::::::::::.:.::: ::::::::
--ACAGCTTCACCGTCTACTTCCTCCACCTCATCTCGTTCCAAAGCTTCAAAGGAGACCGTTTCTAGCAAAACGGGGACAGTGGGAATCACAAAGGGCAA
\--S--A--S--P--S--T--S--S--T--S--S--R--S--K--A--S--K--E--T--V--S--S--K--T--G--T--V--G--I--T--K--G--K

----------------------------------------------------------------------------------------------------
--R--K--T--D--K--Q--P--I--T--S--H--L--S--S--D--T--T--T--S--G--T--S--D--L--K--G--E--P--A--E--T--R--V-
GAGAAAAACTGACAAGCAGCCAATAACTTCTCACCTGTCCTCAGACACAACAACTTCTGGCACATCCGACCTGAAAGGAGAGCCTGCAGAGACCAGAGTG
::.::::::::.:::::::    :.:: ::::: :..::::::::..:::: ::::::::::::::.::::: :::::::::::: : ::: :: :.:::
GAAAAAAACTGGCAAGCAG---CTGACGTCTCAGCCATCCTCAGATGCAACCACTTCTGGCACATCTGACCTTAAAGGAGAGCCTTCCGAGCCCCGGGTG
--K--K--T--G--K--Q-----L--T--S--Q--P--S--S--D--A--T--T--S--G--T--S--D--L--K--G--E--P--S--E--P--R--V-

----------------------------------------------------------------------------------------------------
-E--S--F--K--L--E--Q--T--V--P--G--A--E--E--Q--N--T--G--K--F--K--S--M--V--P--P--P--P--V--A--P--A--P--
GAGAGTTTCAAACTCGAACAGACTGTCCCTGGAGCTGAGGAGCAGAACACAGGCAAATTCAAGTCCATGGTCCCTCCACCCCCTGTGGCTCCAGCACCTT
::::::.::::::..::.:::::::::::::...: :::::::::: :::::::::: .::::::....:::::::.. :::::::::::::  ::::..
GAGAGTCTCAAACCTGAGCAGACTGTCCCTGAGACGGAGGAGCAGACCACAGGCAAAGCCAAGTCTGCAGTCCCTCTGGCCCCTGTGGCTCCCCCACCCC
-E--S--L--K--P--E--Q--T--V--P--E--T--E--E--Q--T--T--G--K--A--K--S--A--V--P--L--A--P--V--A--P--P--P--

----------------------------------------------------------------------------------------------------
S--P--L--A--P--P--L--P--L--E--D--Q--C--I--T--A--S--D--T--P--V--V--L--V--S--V--G--A--D--L--P--V--S--A
CTCCTCTGGCCCCCCCTCTCCCTCTTGAGGATCAGTGCATTACTGCCTCAGACACTCCAGTTGTCCTCGTCAGCGTTGGAGCTGACCTGCCCGTCTCTGC
::::.::: ::::.:: ::::: :: :::::.::: ::::...::::::::::::::: ::.::::: .:::::. :::::::::::::::::::.::::
CTCCCCTGCCCCCTCCGCTCCCGCTGGAGGACCAGAGCATCGTTGCCTCAGACACTCCTGTCGTCCTGATCAGCAATGGAGCTGACCTGCCCGTCCCTGC
P--P--L--P--P--P--L--P--L--E--D--Q--S--I--V--A--S--D--T--P--V--V--L--I--S--N--G--A--D--L--P--V--P--A

--------------------------------------------------------------------------------------------------><
--L--D--P--S--Q--L--L--W--A--E--E--P--T--N--R--T--T--L--Y--S--G--T--G--L--S--V--N--R--E--N--A--K--C-
CTTAGACCCAAGTCAGCTTCTTTGGGCTGAAGAGCCGACGAACAGAACCACTCTCTACTCAGGCACTGGCTTAAGTGTTAACAGAGAAAATGCAAAATGT
::: :::::::::::::::::.:::.:::::::::::::...::::::.::: ::.:.::::::::::::::::::::::.::::::::::: ::::   
CTTCGACCCAAGTCAGCTTCTCTGGACTGAAGAGCCGACAGGCAGAACTACTGTCCATTCAGGCACTGGCTTAAGTGTTAGCAGAGAAAATGGAAAA---
--F--D--P--S--Q--L--L--W--T--E--E--P--T--G--R--T--T--V--H--S--G--T--G--L--S--V--S--R--E--N--G--K----

----------------------------------------------------------------------------------------------------
-F--T--T--K--E--E--L--G--K--T--V--P--Q--L--L--T--P--G--L--M--G--E--S--S--E--S--F--S--A--S--E--D--E--
TTCACAACCAAAGAGGAGCTGGGGAAGACAGTGCCTCAGCTACTGACTCCTGGGCTGATGGGCGAATCTTCAGAATCCTTTAGTGCCTCAGAAGATGAAG
::: : :::::::: ::::::::::::.:::.::::::::: :::::::::::::::::::: ::::::::::::::.::.:::::::::::.::.::::
TTCTCTACCAAAGATGAGCTGGGGAAGGCAGCGCCTCAGCTCCTGACTCCTGGGCTGATGGGAGAATCTTCAGAATCTTTCAGTGCCTCAGAGGACGAAG
-F--S--T--K--D--E--L--G--K--A--A--P--Q--L--L--T--P--G--L--M--G--E--S--S--E--S--F--S--A--S--E--D--E--

----------------------------------------------------------------------------------------------------
G--H--R--E--Y--Q--A--N--D--S--D--S--D--G--P--I--L--Y--T--D--D--E--D--------E--D--E--D--E--D--G--S--G
GCCACAGGGAATACCAAGCCAATGACTCTGACTCGGACGGGCCTATCTTGTACACCGATGATGAGGAC------GAAGACGAAGATGAGGATGGCAGTGG
:::  :::::.:::::.::::::::::::::::: ::.::.::.:::.:::::::.::.::.:: ::.      ::.::.::.:::::.::.::::::::
GCCCAAGGGAGTACCAGGCCAATGACTCTGACTCTGATGGACCCATCCTGTACACTGACGACGACGATGATGAAGAGGATGAGGATGAAGACGGCAGTGG
G--P--R--E--Y--Q--A--N--D--S--D--S--D--G--P--I--L--Y--T--D--D--D--D--D--E--E--D--E--D--E--D--G--S--G

----><----------------------------------------------------------------------------------------------
--E--S--A--L--A--S--K--I--R--R--R--D--T--L--A--I--K--L--G--N--R--P--S--K--K--E--L--E--D--K--N--I--L-
AGAAAGTGCTTTGGCAAGTAAAATACGCCGGAGGGATACTCTTGCTATCAAACTTGGCAACAGACCATCTAAGAAAGAACTAGAGGACAAAAACATCTTG
::::   :::::::::::::::::::: ::.:::::::::::::: ::::::::.::::::::::::::::::::::::.::::::::::::::::::::
AGAA---GCTTTGGCAAGTAAAATACGACGAAGGGATACTCTTGCAATCAAACTCGGCAACAGACCATCTAAGAAAGAATTAGAGGACAAAAACATCTTG
--E-----A--L--A--S--K--I--R--R--R--D--T--L--A--I--K--L--G--N--R--P--S--K--K--E--L--E--D--K--N--I--L-

-------------------------------------------------------------><-------------------------------------
-Q--R--T--S--E--E--E--R--Q--E--I--R--Q--Q--I--G--T--K--L--V--R--R--L--S--Q--R--P--T--T--E--E--L--E--
CAGCGTACATCTGAAGAAGAGAGGCAGGAAATCCGACAACAAATTGGAACCAAGTTAGTCAGGAGGCTGAGCCAGAGGCCCACAACTGAAGAATTAGAGC
::::: :::::::::::.::::::::::::::::::::::::::::::::::::.:::::   ::.:: :::::::::::::::::::::::::::::.:
CAGCGAACATCTGAAGAGGAGAGGCAGGAAATCCGACAACAAATTGGAACCAAGCTAGTC---AGACTTAGCCAGAGGCCCACAACTGAAGAATTAGAAC
-Q--R--T--S--E--E--E--R--Q--E--I--R--Q--Q--I--G--T--K--L--V-----R--L--S--Q--R--P--T--T--E--E--L--E--

-----------------><------------------------------------------------------------><-------------------
Q--R--N--I--L--K--Q--K--N--E--E--E--E--Q--E--A--K--M--E--L--K--R--R--L--S--R--K--L--S--L--R--P--T--V
AAAGAAACATCCTAAAACAAAAGAATGAAGAAGAGGAACAAGAAGCAAAAATGGAACTTAAACGCAGACTCAGCAGAAAGCTCAGCCTGAGACCCACAGT
:::::::.:::::.      ::::::::::::::.::.:::::::::::::::::::::::::::::::::::: :::::::::::::::::::::::::
AAAGAAATATCCTG------AAGAATGAAGAAGAAGAGCAAGAAGCAAAAATGGAACTTAAACGCAGACTCAGCCGAAAGCTCAGCCTGAGACCCACAGT
Q--R--N--I--L--------K--N--E--E--E--E--Q--E--A--K--M--E--L--K--R--R--L--S--R--K--L--S--L--R--P--T--V

----------------------------------------------------------------------------------------------------
--A--E--L--Q--A--R--R--I--L--R--F--N--E--Y--V--E--V--T--D--S--P--D--Y--D--R--R--A--D--K--P--W--A--R-
GGCAGAGCTACAAGCTCGAAGGATCCTGCGATTTAACGAGTATGTAGAAGTCACGGATTCTCCTGACTATGACCGCCGAGCAGACAAGCCCTGGGCCAGG
:::::::::.::::::::::::::::::::.:::::.::::::::::::::::: ::::: :: ::::::::.:::::::::::::::::.:::::::::
GGCAGAGCTGCAAGCTCGAAGGATCCTGCGGTTTAATGAGTATGTAGAAGTCACCGATTCGCCAGACTATGATCGCCGAGCAGACAAGCCTTGGGCCAGG
--A--E--L--Q--A--R--R--I--L--R--F--N--E--Y--V--E--V--T--D--S--P--D--Y--D--R--R--A--D--K--P--W--A--R-

-----------------------------><---------------------------------------------------------------------
-L--T--P--A--D--K--A--R--I--P--A--A--I--R--K--E--L--N--E--F--K--S--T--E--M--E--V--H--E--E--S--R--Q--
TTAACACCTGCAGACAAGGCAAGAATCCCAGCAGCAATAAGGAAAGAACTAAATGAATTTAAAAGCACAGAAATGGAAGTTCATGAAGAGAGTCGACAGT
:::::.::::::::::::::          :: :::::::::::::::::::::::::::::::::::.::::::::::::::::::::.::::::::::
TTAACGCCTGCAGACAAGGCC---------GCCGCAATAAGGAAAGAACTAAATGAATTTAAAAGCACGGAAATGGAAGTTCATGAAGAAAGTCGACAGT
-L--T--P--A--D--K--A-----------A--A--I--R--K--E--L--N--E--F--K--S--T--E--M--E--V--H--E--E--S--R--Q--

------><-------------->
F--T--R--F--H--R--P--*-
TTACAAGGTTTCATCGTCCATAA
::                     
TT---------------------
F----------------------

Pig Consensus Sequence

>BGISUST0000892752
------GTTGATGGACTGGACAAAGCTTCTATAGCAAACTCAGATGGCCCAACAGCAGGTTCCCAAACACCTCCCTTCAAGAGAAAGGGGAAGCTCTCCA
CCATCGGTAAAATCTTTAAGCCTTGGAAATGGAGGAAAAAGAAGACCAGTGACAAATTTAGAGAAACATCAGCA---TTAGAAAGGAAGATTTCCACAAG
ACAAAGTAGAGAGGAGCTGATAAGAAGGGGAGTTCTTAAGGAATTGCCTGATCAA---GGAGATGTAACAGTTAACTTTGAAAATTCAAACGGGCACATg
aTACCCATCGGAGAGGAGTCTACCCGAGAGGAAAATATAGTAAAAACTGAAGAAGGGAATGGCTCTGTAGCTGAAAAAGCACCACCTCTGGAGGAAAAGG
CAGAAGATAAGAAA---AACACTGAAAACCACTTTGAAACACCGGCAGCTCCTGTTCCACCTCCTCCAGCTCTTCATAAGCATAAACCCAAACTTAAACC
CAAAAAAACACCTGTGCCTCCAAAAGGGGCCGCTGCCGGGGCCAGCCCCAAGGGTGATGAAGTGCCTCCTATTAAAAAAAATACCAAGACTCCTGGTAAG
CAGGTCCCTGTCCCTCTACCCAAGCCAACAAGCCGAAATGCTACCCGAGAGGCT---GGTTCCTCTCATTCAAGAAAAACAACTGGCTCTAAAGCaaCAG
CTTCACCGTCTACTTCCTCCACCTCATCTCGTTCCAAAGCTTCAAAGGAGACCGTTTCTAGCAAAACGGGGACAGTGGGAATCACAAAGGGCAAGAAAAA
AACTGGCAAGCAGCTGACGTCTCAGCCATCCTCAGATGCAACCACTTCTGGCACATCTGACCTTAAAGGAGAGCCTTCCGAGCCCCGGGTGGAGAGTCTC
AAACCTGAGCAGACTGTCCCTGAGACGGAGGAGCAGACCACAGGCAAAGCCAAGTCTGCAGTCCCTCTGGCCCCTGTGGCTCCCCCACCCCCTCCCCTGC
CCCCTCCGCTCCCGCTGGAGGACCAGAGCATCGTTGCCTCAGACACTCCTGTCGTCCTGATCAGCAATGGAGCTGACCTGCCCGTCCCTGCCTTCGACCC
AAGTCAGCTTCTCTGGACTGAAGAGCCGACAGGCAGAACTACTGTCCATTCAGGCACTGGCTTAAGTGTTAGCAGAGAAAATGGAAAA---TTCTCTACC
AAAGATGAGCTGGGGAAGGCAGCGCCTCAGCTCCTGACTCCTGGGCTGATGGGAGAATCTTCAGAATCTTTCAGTGCCTCAGAGGACGAAGGCCCAAGGG
AGTACCAGGCCAATGACTCTGACTCTGATGGACCCATCCTGTACACTGACGACGACGATGATGAAGAGGATGAGGATGAAGACGGCAGT---GCTTTGGC
AAGTAAAATACGACGAAGGGATACTCTTGCAATCAAACTCGGCAACAGACCATCTAAGAAAGAATTAGAGGACAAAAACATCTTGCAGCGAACATCTGAA
GAGGAGAGGCAGGAAATCCGACAACAAATTGGAACCAAGCTAGTC---AGACTTAGCCAGAGGCCCACAACTGAAGAATTAGAACAAAGAAATATCCTG-
-----AAGAATGAAGAAGAAGAGCAAGAAGCAAAAATGGAACTTAAACGCAGACTCAGCCGAAAGCTCAGCCTGAGACCCACAGTGGCAGAGCTGCAAGC
TCGAAGGATCCTGCGGTTTAATGAGTATGTAGAAGTCACCGATTCGCCAGACTATGATCGCCGAGCAGACAAGCCTTGGGCCAGGTTAACGCCTGCAGAC
AAGGCC---------GCCGCAATAAGGAAAGAACTAAATGAATTTAAAAGCACGGAAATGGAAGTTCATGAAGAAAGTCGACAGTTT-------------
--------


>BGISUSP0000892752
--VDGLDKASIANSDGPTAGSQTPPFKRKGKLSTIGKIFKPWKWRKKKTSDKFRETSA-LERKISTRQSREELIRRGVLKELPDQ-GDVTVNFENSNGHM
IPIGEESTREENIVKTEEGNGSVAEKAPPLEEKAEDKK-NTENHFETPAAPVPPPPALHKHKPKLKPKKTPVPPKGAAAGASPKGDEVPPIKKNTKTPGK
QVPVPLPKPTSRNATREA-GSSHSRKTTGSKATASPSTSSTSSRSKASKETVSSKTGTVGITKGKKKTGKQLTSQPSSDATTSGTSDLKGEPSEPRVESL
KPEQTVPETEEQTTGKAKSAVPLAPVAPPPPPLPPPLPLEDQSIVASDTPVVLISNGADLPVPAFDPSQLLWTEEPTGRTTVHSGTGLSVSRENGK-FST
KDELGKAAPQLLTPGLMGESSESFSASEDEGPREYQANDSDSDGPILYTDDDDDEEDEDEDGS-ALASKIRRRDTLAIKLGNRPSKKELEDKNILQRTSE
EERQEIRQQIGTKLV-RLSQRPTTEELEQRNIL--KNEEEEQEAKMELKRRLSRKLSLRPTVAELQARRILRFNEYVEVTDSPDYDRRADKPWARLTPAD
KA---AAIRKELNEFKSTEMEVHEESRQF-------