Sequences
EST Library Info
ecc2Foetus 50 days, cortex cerebri
eep1Foetus 50 days, epidermis
ese3Foetus 50 days, M. semitendinosus
fat1Fatt
lin1Large intestine
med1Mediastinum
mgp3Mammary gland - 7 days pre birth
ova3Ovary
pigcb2Unavailable
relu2Unavailable
sin2Small intestine
spl1Spleen
thg4Thyroid gland
tra1Trachea
Clusters
Oligos
SNPs

Gene ID ENSG00000170312 (click for geneview)
Transcript ID ENST00000307250(link to ensembl)
Symbol CDC2
Localtion Chromosome:10:62208242:62223930:1 band: 10q21.2
Description Cell division control protein 2 homolog (EC 2.7.1.37) (p34 protein kinase) (Cyclin-dependent kinase 1) (CDK1). [Source:Uniprot/SWISSPROT;Acc:P06493]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-----------------------------------><--------------------------------------------------------------
-M--E--D--Y--T--K--I--E--K--I--G--E--G--T--Y--G--V--V--Y--K--G--R--H--K--T--T--G--Q--V--V--A--M--K--
ATGGAAGATTATACCAAAATAGAGAAAATTGGAGAAGGTACCTATGGAGTTGTGTATAAGGGTAGACACAAAACTACAGGTCAAGTGGTAGCCATGAAAA
                                       :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.:
---------------------------------------ACCTATGGAGTTGTGTATAAGGGTAGACACAAAACTACAGGTCAAGTGGTAGCCATGAAGA
----------------------------------------T--Y--G--V--V--Y--K--G--R--H--K--T--T--G--Q--V--V--A--M--K--

---------------------------------------------------------------------------------------------><-----
K--I--R--L--E--S--E--E--E--G--V--P--S--T--A--I--R--E--I--S--L--L--K--E--L--R--H--P--N--I--V--S--L--Q
AAATCAGACTAGAAAGTGAAGAGGAAGGGGTTCCTAGTACTGCAATTCGGGAAATTTCTCTATTAAAGGAACTTCGTCATCCAAATATAGTCAGTCTTCA
:::::::.:::::::::::::::::::: :::::::::::::: :::::.::::: :::::::::::.::::::::.:::::::::::::::   :::::
AAATCAGGCTAGAAAGTGAAGAGGAAGGTGTTCCTAGTACTGCCATTCGAGAAATATCTCTATTAAAAGAACTTCGCCATCCAAATATAGTC---CTTCA
K--I--R--L--E--S--E--E--E--G--V--P--S--T--A--I--R--E--I--S--L--L--K--E--L--R--H--P--N--I--V-----L--Q

----------------------------------------------------------------------------------------------------
--D--V--L--M--Q--D--S--R--L--Y--L--I--F--E--F--L--S--M--D--L--K--K--Y--L--D--S--I--P--P--G--Q--Y--M-
GGATGTGCTTATGCAGGATTCCAGGTTATATCTCATCTTTGAGTTTCTTTCCATGGATCTGAAGAAATACTTGGATTCTATCCCTCCTGGTCAGTACATG
.::::::::::::::.::.:::::::::::::::::::::::.::.:::::.:::::::: :::::::::::::::::::::::::::::::::: ::::
AGATGTGCTTATGCAAGACTCCAGGTTATATCTCATCTTTGAATTCCTTTCTATGGATCTCAAGAAATACTTGGATTCTATCCCTCCTGGTCAGTTCATG
--D--V--L--M--Q--D--S--R--L--Y--L--I--F--E--F--L--S--M--D--L--K--K--Y--L--D--S--I--P--P--G--Q--F--M-

-----------------><---------------------------------------------------------------------------------
-D--S--S--L--V--K--S--Y--L--Y--Q--I--L--Q--G--I--V--F--C--H--S--R--R--V--L--H--R--D--L--K--P--Q--N--
GATTCTTCACTTGTTAAGAGTTATTTATACCAAATCCTACAGGGGATTGTGTTTTGTCACTCTAGAAGAGTTCTTCACAGAGACTTAAAACCTCAAAATC
::::::::::::::::::::::::::.:::::::::::.::.::::::::::::::::::::: ::::::::.: :::::::::::::::::::::::::
GATTCTTCACTTGTTAAGAGTTATTTGTACCAAATCCTGCAAGGGATTGTGTTTTGTCACTCTCGAAGAGTTTTACACAGAGACTTAAAACCTCAAAATC
-D--S--S--L--V--K--S--Y--L--Y--Q--I--L--Q--G--I--V--F--C--H--S--R--R--V--L--H--R--D--L--K--P--Q--N--

--------------------------------------------------------------------------------------------><------
L--L--I--D--D--K--G--T--I--K--L--A--D--F--G--L--A--R--A--F--G--I--P--I--R--V--Y--T--H--E--A--I--T--L
TCTTGATTGATGACAAAGGAACAATTAAACTGGCTGATTTTGGCCTTGCCAGAGCTTTTGGAATACCTATCAGAGTATATACACATGAGGCAATAACACT
: :::::::::::.:::::::::::::::::::: ::::::::.:::::::::::::::::.::::::::.::::::::::::::::::      :::::
TATTGATTGATGATAAAGGAACAATTAAACTGGCAGATTTTGGTCTTGCCAGAGCTTTTGGGATACCTATTAGAGTATATACACATGAG------ACACT
L--L--I--D--D--K--G--T--I--K--L--A--D--F--G--L--A--R--A--F--G--I--P--I--R--V--Y--T--H--E--------T--L

----------------------------------------------------------------------------------------------------
--W--Y--R--S--P--E--V--L--L--G--S--A--R--Y--S--T--P--V--D--I--W--S--I--G--T--I--F--A--E--L--A--T--K-
CTGGTACAGATCTCCAGAAGTATTGCTGGGGTCAGCTCGTTACTCAACTCCAGTTGACATTTGGAGTATAGGCACCATATTTGCTGAACTAGCAACTAAG
::::::.::::::::::::::::::::::::::::::::.:::::::::::::::::.::::::::::::::.:::::::::::.:::::::::::::::
CTGGTATAGATCTCCAGAAGTATTGCTGGGGTCAGCTCGCTACTCAACTCCAGTTGATATTTGGAGTATAGGTACCATATTTGCCGAACTAGCAACTAAG
--W--Y--R--S--P--E--V--L--L--G--S--A--R--Y--S--T--P--V--D--I--W--S--I--G--T--I--F--A--E--L--A--T--K-

----------------------------------------------------><----------------------------------------------
-K--P--L--F--H--G--D--S--E--I--D--Q--L--F--R--I--F--R--A--L--G--T--P--N--N--E--V--W--P--E--V--E--S--
AAACCACTTTTCCATGGGGATTCAGAAATTGATCAACTCTTCAGGATTTTCAGAGCTTTGGGCACTCCCAATAATGAAGTGTGGCCAGAAGTGGAATCTT
::::::::::::::.::::::::::::::.::::::::::::::.::::::   :::::::::::::::::::::::::::::::::::::::::.::::
AAACCACTTTTCCACGGGGATTCAGAAATCGATCAACTCTTCAGAATTTTC---GCTTTGGGCACTCCCAATAATGAAGTGTGGCCAGAAGTGGAGTCTT
-K--P--L--F--H--G--D--S--E--I--D--Q--L--F--R--I--F-----A--L--G--T--P--N--N--E--V--W--P--E--V--E--S--

----------------------------------------------------------------------------------------------><----
L--Q--D--Y--K--N--T--F--P--K--W--K--P--G--S--L--A--S--H--V--K--N--L--D--E--N--G--L--D--L--L--S--K--M
TACAGGACTATAAGAATACATTTCCCAAATGGAAACCAGGAAGCCTAGCATCCCATGTCAAAAACTTGGATGAAAATGGCTTGGATTTGCTCTCGAAAAT
::::::::::::::::::::::::::::.::::::::::::::::::::::::::.::::::::::::::::::::::::::::::.:::::::::::::
TACAGGACTATAAGAATACATTTCCCAAGTGGAAACCAGGAAGCCTAGCATCCCACGTCAAAAACTTGGATGAAAATGGCTTGGATCTGCTCTCGAAAAT
L--Q--D--Y--K--N--T--F--P--K--W--K--P--G--S--L--A--S--H--V--K--N--L--D--E--N--G--L--D--L--L--S--K--M

--------------------------------------------------------------------------------------------->
--L--I--Y--D--P--A--K--R--I--S--G--K--M--A--L--N--H--P--Y--F--N--D--L--D--N--Q--I--K--K--M--*-
GTTAATCTATGATCCAGCCAAACGAATTTCTGGCAAAATGGCACTGAATCATCCATATTTTAATGATTTGGACAATCAGATTAAGAAGATGTAG
::::.:::::::::: :::::.::::::::::::::::::::::::::::::::::::::::::::::::::::::::..::::::..::::::
GTTAGTCTATGATCCTGCCAAGCGAATTTCTGGCAAAATGGCACTGAATCATCCATATTTTAATGATTTGGACAATCAAGTTAAGAGAATGTAG
--L--V--Y--D--P--A--K--R--I--S--G--K--M--A--L--N--H--P--Y--F--N--D--L--D--N--Q--V--K--R--M--*-

Pig Consensus Sequence

>BGISUST0000881045
---------------------------------------ACCTATGGAGTTGTGTATAAGGGTAGACACAAAACTACAGGTCAAGTGGTAGCCATGAAGA
AAATCAGGCTAGAAAGTGAAGAGGAAGGTGTTCCTAGTACTGCCATTCGAGAAATATCTCTATTAAAAGAACTTCGCCATCCAAATATAGTC---CTTCA
AGATGTGCTTATGCAAGACTCCAGGTTATATCTCATCTTTGAATTCCTTTCTATGGATCTCAAGAAATACTTGGATTCTATCCCTCCTGGTCAGTTCATG
GATTCTTCACTTGTTAAGAGTTATTTGTACCAAATCCTGCAAGGGATTGTGTTTTGTCACTCTCGAAGAGTTTTACACAGAGACTTAAAACCTCAAAATC
TATTGATTGATGATAAAGGAACAATTAAACTGGCAGATTTTGGTCTTGCCAGAGCTTTTGGGATACCTATTAGAGTATATACACATGAG------ACACT
CTGGTATAGATCTCCAGAAGTATTGCTGGGGTCAGCTCGCTACTCAACTCCAGTTGATATTTGGAGTATAGGTACCATATTTGCCGAACTAGCAACTAAG
AAACCACTTTTCCACGGGGATTCAGAAATCGATCAACTCTTCAGAATTTTC---GCTTTGGGCACTCCCAATAATGAAGTGTGGCCAGAAGTGGAGTCTT
TACAGGACTATAAGAATACATTTCCCAAGTGGAAACCAGGAAGCCTAGCATCCCACGTCAAAAACTTGGATGAAAATGGCTTGGATCTGCTCTCGAAAAT
GTTAGTCTATGATCCTGCCAAGCGAATTTCTGGCAAAATGGCACTGAATCATCCATATTTTAATGATTTGGACAATCAAGTTAAGAGAATGTAG


>BGISUSP0000881045
-------------TYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRHPNIV-LQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQFM
DSSLVKSYLYQILQGIVFCHSRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHE--TLWYRSPEVLLGSARYSTPVDIWSIGTIFAELATK
KPLFHGDSEIDQLFRIF-ALGTPNNEVWPEVESLQDYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLVYDPAKRISGKMALNHPYFNDLDNQVKRM*