Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000172350 (click for geneview)
Transcript ID ENST00000307417(link to ensembl)
Symbol ABCG4
Localtion Chromosome:11:118524960:118538582:1 band: 11q23.3
Description ATP-binding cassette, sub-family G, member 4. [Source:Uniprot/SWISSPROT;Acc:Q9H172]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--A--E--K--A--L--E--A--V--G--C--G--L--G--P--G--A--V--A--M--A--V--T--L--E--D--G--A--E--P--P--V--L--
ATGGCGGAGAAGGCGCTGGAGGCCGTGGGCTGTGGACTAGGGCCGGGGGCTGTGGCCATGGCCGTGACGCTGGAGGACGGGGCGGAACCCCCTGTGCTGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
T--T--H--L--K--K--V--E--N--H--I--T--E--A--Q--R--F--S--H--L--P--K--R--S--A--V--D--I--E--F--V--E--L--S
CCACGCACCTGAAGAAGGTGGAGAACCACATCACTGAAGCCCAGCGCTTCTCCCACCTACCCAAGCGCTCAGCCGTGGACATCGAGTTCGTGGAGCTGTC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------------------><-------------------------------------------------------------
--Y--S--V--R--E--G--P--C--W--R--K--R--G--Y--K--T--L--L--K--C--L--S--G--K--F--C--R--R--E--L--I--G--I-
CTATTCCGTGCGGGAGGGGCCCTGCTGGCGCAAAAGGGGTTATAAGACCCTTCTCAAGTGCCTCTCAGGTAAATTCTGCCGCCGGGAGCTGATTGGCATC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------------------------------------><-------------------------------------------
-M--G--P--S--G--A--G--K--S--T--F--M--N--I--L--A--G--Y--R--E--S--G--M--K--G--Q--I--L--V--N--G--R--P--
ATGGGCCCCTCAGGGGCTGGCAAGTCTACATTCATGAACATCTTGGCAGGATACAGGGAGTCTGGAATGAAGGGGCAGATCCTGGTTAATGGAAGGCCAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------><----------
R--E--L--R--T--F--R--K--M--S--C--Y--I--M--Q--D--D--M--L--L--P--H--L--T--V--L--E--A--M--M--V--S--A--N
GGGAGCTGAGGACCTTCCGCAAGATGTCCTGCTACATCATGCAAGATGACATGCTGCTGCCGCACCTCACGGTGTTGGAAGCCATGATGGTCTCTGCTAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------------------------------------><-----------------------------------------------------------
--L--K--L--S--E--K--Q--E--V--K--K--E--L--V--T--E--I--L--T--A--L--G--L--M--S--C--S--H--T--R--T--A--L-
CCTGAAGCTGAGTGAGAAGCAGGAGGTGAAGAAGGAGCTGGTGACAGAGATCCTGACGGCACTGGGCCTGATGTCGTGCTCCCACACGAGGACAGCCCTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------------------------------------------------------------------><-------------
-L--S--G--G--Q--R--K--R--L--A--I--A--L--E--L--V--N--N--P--P--V--M--F--F--D--E--P--T--S--G--L--D--S--
CTCTCTGGCGGGCAGAGGAAGCGTCTGGCCATCGCCCTGGAGCTGGTCAACAACCCGCCTGTCATGTTCTTTGATGAGCCCACCAGTGGTCTGGATAGCG
                                                                                       ::::::::.::::
---------------------------------------------------------------------------------------GGTCTGGACAGCG
----------------------------------------------------------------------------------------G--L--D--S--

----------------------------------------------------------------------------------------------------
A--S--C--F--Q--V--V--S--L--M--K--S--L--A--Q--G--G--R--T--I--I--C--T--I--H--Q--P--S--A--K--L--F--E--M
CCTCTTGTTTCCAAGTGGTGTCCCTCATGAAGTCCCTGGCACAGGGGGGCCGTACCATCATCTGCACCATCCACCAGCCCAGTGCCAAGCTCTTTGAGAT
::::.::::::::::::::::::::::::::::: ::::: ::::::::::::::::::::.::::::::::::::::::::::::::::::::::::::
CCTCCTGTTTCCAAGTGGTGTCCCTCATGAAGTCGCTGGCCCAGGGGGGCCGTACCATCATTTGCACCATCCACCAGCCCAGTGCCAAGCTCTTTGAGAT
A--S--C--F--Q--V--V--S--L--M--K--S--L--A--Q--G--G--R--T--I--I--C--T--I--H--Q--P--S--A--K--L--F--E--M

---------><-----------------------------------------------------------------------------------------
--F--D--K--L--Y--I--L--S--Q--G--Q--C--I--F--K--G--V--V--T--N--L--I--P--Y--L--K--G--L--G--L--H--C--P-
GTTTGACAAGCTCTACATCCTGAGCCAGGGTCAGTGCATCTTCAAAGGCGTGGTCACCAACCTGATCCCCTATCTAAAGGGACTCGGCTTGCATTGCCCC
::::::::::                                                                                          
GTTTGACAAG------------------------------------------------------------------------------------------
--F--D--K-------------------------------------------------------------------------------------------

------------------------><--------------------------------------------------------------------------
-T--Y--H--N--P--A--D--F--I--I--E--V--A--S--G--E--Y--G--D--L--N--P--M--L--F--R--A--V--Q--N--G--L--C--
ACCTACCACAACCCGGCTGACTTCATCATCGAGGTGGCCTCTGGCGAGTATGGAGACCTGAACCCCATGTTGTTCAGGGCTGTGCAGAATGGGCTGTGCG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------------------------------------------------><-------------------------------
A--M--A--E--K--K--S--S--P--E--K--N--E--V--P--A--P--C--P--P--C--P--P--E--V--D--P--I--E--S--H--T--F--A
CTATGGCTGAGAAGAAGAGCAGCCCTGAGAAGAACGAGGTCCCTGCCCCATGCCCTCCTTGTCCTCCGGAAGTGGATCCCATTGAAAGCCACACCTTTGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------------------------------------------------------------><--------------------------------
--T--S--T--L--T--Q--F--C--I--L--F--K--R--T--F--L--S--I--L--R--D--T--V--L--T--H--L--R--F--M--S--H--V-
CACCAGCACCCTCACACAGTTCTGCATCCTCTTCAAGAGGACCTTCCTGTCCATCCTCAGGGACACGGTCCTGACCCACCTACGGTTCATGTCCCACGTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-V--I--G--V--L--I--G--L--L--Y--L--H--I--G--D--D--A--S--K--V--F--N--N--T--G--C--L--F--F--S--M--L--F--
GTTATTGGCGTGCTCATCGGCCTCCTCTACCTGCATATTGGCGACGATGCCAGCAAGGTCTTCAACAACACCGGCTGCCTCTTCTTCTCCATGCTGTTCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----------------------------------><---------------------------------------------------------------
L--M--F--A--A--L--M--P--T--V--L--T--F--P--L--E--M--A--V--F--M--R--E--H--L--N--Y--W--Y--S--L--K--A--Y
TCATGTTCGCCGCCCTCATGCCAACTGTGCTCACCTTCCCCTTAGAGATGGCGGTCTTCATGAGGGAGCACCTCAACTACTGGTACAGCCTCAAAGCGTA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------------------------------><--------------------------------------------------------------
--Y--L--A--K--T--M--A--D--V--P--F--Q--V--V--C--P--V--V--Y--C--S--I--V--Y--W--M--T--G--Q--P--A--E--T-
TTACCTGGCCAAGACCATGGCTGACGTGCCCTTTCAGGTGGTGTGTCCGGTGGTCTACTGCAGCATTGTGTACTGGATGACGGGCCAGCCCGCTGAGACC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----------------------------------------------------------------------------------------------><---
-S--R--F--L--L--F--S--A--L--A--T--A--T--A--L--V--A--Q--S--L--G--L--L--I--G--A--A--S--N--S--L--Q--V--
AGCCGCTTCCTGCTCTTCTCAGCCCTGGCCACCGCCACCGCCTTGGTGGCCCAATCTTTGGGGCTGCTGATCGGAGCTGCTTCCAACTCCCTACAGGTGG
                                                                                                ::::
------------------------------------------------------------------------------------------------GTGG
-------------------------------------------------------------------------------------------------V--

----------------------------------------------------------------------------------------------------
A--T--F--V--G--P--V--T--A--I--P--V--L--L--F--S--G--F--F--V--S--F--K--T--I--P--T--Y--L--Q--W--S--S--Y
CCACTTTTGTGGGCCCAGTTACCGCCATCCCTGTCCTCTTGTTCTCCGGCTTCTTTGTCAGCTTCAAGACCATCCCCACTTACCTGCAATGGAGCTCCTA
::::.::::::::.:::::::::::::::::.:::::::::::::::::.::::::::::::::.:::::::::::::: ::::::::::::::::: ::
CCACCTTTGTGGGTCCAGTTACCGCCATCCCCGTCCTCTTGTTCTCCGGTTTCTTTGTCAGCTTTAAGACCATCCCCACGTACCTGCAATGGAGCTCGTA
A--T--F--V--G--P--V--T--A--I--P--V--L--L--F--S--G--F--F--V--S--F--K--T--I--P--T--Y--L--Q--W--S--S--Y

--------------><------------------------------------------------------------------------------------
--L--S--Y--V--R--Y--G--F--E--G--V--I--L--T--I--Y--G--M--E--R--G--D--L--T--C--L--E--E--R--C--P--F--R-
TCTCTCCTATGTCAGGTATGGCTTTGAGGGTGTGATCCTGACGATCTATGGCATGGAGCGAGGAGACCTGACATGTTTAGAGGAACGCTGCCCGTTCCGG
.::::::::::::   ::::::::::::::::::::.::::: :::::::::::::::::::::::::: :: ::.::.:::::::::::::: ::::::
CCTCTCCTATGTC---TATGGCTTTGAGGGTGTGATTCTGACCATCTATGGCATGGAGCGAGGAGACCTCACCTGCTTGGAGGAACGCTGCCCTTTCCGG
--L--S--Y--V-----Y--G--F--E--G--V--I--L--T--I--Y--G--M--E--R--G--D--L--T--C--L--E--E--R--C--P--F--R-

----------------------------------------------------------------------------------------------------
-E--P--Q--S--I--L--R--A--L--D--V--E--D--A--K--L--Y--M--D--F--L--V--L--G--I--F--F--L--A--L--R--L--L--
GAGCCACAGAGCATCCTCCGAGCGCTGGATGTGGAGGATGCCAAGCTCTACATGGACTTCCTGGTCTTGGGCATCTTCTTCCTAGCCCTGCGGCTGCTGG
::::::::::::::::::::::::::::::::.:::::::::::::::::::::::::::.::::::::::::::::::::::.::::::::::::::::
GAGCCACAGAGCATCCTCCGAGCGCTGGATGTAGAGGATGCCAAGCTCTACATGGACTTCTTGGTCTTGGGCATCTTCTTCCTGGCCCTGCGGCTGCTGG
-E--P--Q--S--I--L--R--A--L--D--V--E--D--A--K--L--Y--M--D--F--L--V--L--G--I--F--F--L--A--L--R--L--L--

---------------------------------------->
A--Y--L--V--L--R--Y--R--V--K--S--E--R--*-
CCTACCTTGTGCTGCGTTACCGGGTCAAGTCAGAGAGATAG
: ::::::::::: :::::::::::::::::.:::::::::
CATACCTTGTGCTCCGTTACCGGGTCAAGTCGGAGAGATAG
A--Y--L--V--L--R--Y--R--V--K--S--E--R--*-

Pig Consensus Sequence

>BGISUST0000896610
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
---------------------------------------------------------------------------------------GGTCTGGACAGCG
CCTCCTGTTTCCAAGTGGTGTCCCTCATGAAGTCGCTGGCCCAGGGGGGCCGTACCATCATTTGCACCATCCACCAGCCCAGTGCCAAGCTCTTTGAGAT
GTTTGACAAG------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
------------------------------------------------------------------------------------------------GTGG
CCACCTTTGTGGGTCCAGTTACCGCCATCCCCGTCCTCTTGTTCTCCGGTTTCTTTGTCAGCTTTAAGACCATCCCCACGTACCTGCAATGGAGCTCGTA
CCTCTCCTATGTC---TATGGCTTTGAGGGTGTGATTCTGACCATCTATGGCATGGAGCGAGGAGACCTCACCTGCTTGGAGGAACGCTGCCCTTTCCGG
GAGCCACAGAGCATCCTCCGAGCGCTGGATGTAGAGGATGCCAAGCTCTACATGGACTTCTTGGTCTTGGGCATCTTCTTCCTGGCCCTGCGGCTGCTGG
CATACCTTGTGCTCCGTTACCGGGTCAAGTCGGAGAGATAG


>BGISUSP0000896610
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-----------------------------GLDSASCFQVVSLMKSLAQGGRTIICTIHQPSAKLFEMFDK------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
--------------------------------VATFVGPVTAIPVLLFSGFFVSFKTIPTYLQWSSYLSYV-YGFEGVILTIYGMERGDLTCLEERCPFR
EPQSILRALDVEDAKLYMDFLVLGIFFLALRLLAYLVLRYRVKSER*