Sequences
EST Library Info
cbl5Blood
fat1Fatt
nje1Newborn 115 days, jejunum
pldo1Unavailable
thg1Thyroid gland
uio1Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000173559 (click for geneview)
Transcript ID ENST00000307834(link to ensembl)
Symbol Q96AH0_HUMAN
Localtion Chromosome:2:192368368:192377792:1 band: 2q32.3
Description FLJ22833 protein.
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-----------------------------------------------------------------------------------------><--------
-M--N--R--V--N--D--P--L--I--F--I--R--D--I--K--P--G--L--K--N--L--N--V--V--F--I--V--L--E--I--G--R--V--
ATGAATAGGGTCAACGACCCACTTATTTTTATAAGAGATATTAAGCCCGGACTGAAAAACTTAAATGTCGTCTTTATTGTCCTGGAGATAGGACGCGTGA
:::::..::::::::::::: :.: :::::::::.::::::::::::::::::::::::::::::::::::::::::::::.::::::::   :::::::
ATGAACGGGGTCAACGACCCCCCTCTTTTTATAAAAGATATTAAGCCCGGACTGAAAAACTTAAATGTCGTCTTTATTGTCTTGGAGATA---CGCGTGA
-M--N--G--V--N--D--P--P--L--F--I--K--D--I--K--P--G--L--K--N--L--N--V--V--F--I--V--L--E--I-----R--V--

----------------------------------------------------------------------------------------------------
T--K--T--K--D--G--H--E--V--R--S--C--K--V--A--D--K--T--G--S--I--T--I--S--V--W--D--E--I--G--G--L--I--Q
CCAAAACCAAAGACGGCCATGAAGTGAGATCGTGCAAAGTAGCAGATAAAACGGGCAGCATCACTATTTCCGTGTGGGATGAGATCGGAGGTCTTATACA
:::::::::::::::::::::::::::::::.::::::::::::::::::::::::::::::::::::::::::::::::::.:::::::::::.:: ::
CCAAAACCAAAGACGGCCATGAAGTGAGATCATGCAAAGTAGCAGATAAAACGGGCAGCATCACTATTTCCGTGTGGGATGAAATCGGAGGTCTCATTCA
T--K--T--K--D--G--H--E--V--R--S--C--K--V--A--D--K--T--G--S--I--T--I--S--V--W--D--E--I--G--G--L--I--Q

-----------------------------><---------------------------------------------------------------------
--P--G--D--I--I--R--L--T--R--G--Y--A--S--M--W--K--G--C--L--T--L--Y--T--G--R--G--G--E--L--Q--K--I--G-
GCCAGGGGATATTATTCGGTTGACCAGAGGGTATGCATCCATGTGGAAAGGATGTCTGACACTTTATACTGGAAGGGGTGGTGAACTTCAAAAAATTGGG
:::.::::::::::::::::::::::::   :::::::::::::::::::::::::::::::::::::::::::::::::: ::::::::::::::::::
GCCGGGGGATATTATTCGGTTGACCAGA---TATGCATCCATGTGGAAAGGATGTCTGACACTTTATACTGGAAGGGGTGGAGAACTTCAAAAAATTGGG
--P--G--D--I--I--R--L--T--R-----Y--A--S--M--W--K--G--C--L--T--L--Y--T--G--R--G--G--E--L--Q--K--I--G-

-><--------------------------------------------------------------------------><---------------------
-E--F--C--M--V--Y--S--E--V--P--N--F--S--E--P--N--P--D--Y--R--G--Q--Q--N--K--G--A--Q--S--E--Q--K--N--
GAATTTTGTATGGTTTATTCAGAAGTGCCAAATTTCAGTGAACCCAACCCAGATTATCGAGGACAGCAGAACAAAGGGGCACAGAGTGAACAGAAGAATA
   :::::::::::::::::::::::::::::::::::::::::.::::::::::::::::::::.::.:::::::::::::: ::::::::::::::::
---TTTTGTATGGTTTATTCAGAAGTGCCAAATTTCAGTGAACCTAACCCAGATTATCGAGGACAACAAAACAAAGGGGCACATAGTGAACAGAAGAATA
----F--C--M--V--Y--S--E--V--P--N--F--S--E--P--N--P--D--Y--R--G--Q--Q--N--K--G--A--H--S--E--Q--K--N--

--------------------------------------------><------------------------------------------------------
N--S--M--N--S--N--M--G--T--G--T--F--G--P--V--G--N--G--V--H--T--G--P--E--S--R--E--H--Q--F--S--H--A--G
ATTCCATGAATAGTAATATGGGTACAGGTACATTTGGACCAGTGGGAAATGGTGTTCACACTGGCCCTGAATCAAGGGAACACCAGTTTTCACATGCTGG
::::..::::::::::::::::::::::::::::::::::::::   ::.:: :::::  :::::.: ::: ::::::.:..::::::::::.:::::::
ATTCTGTGAATAGTAATATGGGTACAGGTACATTTGGACCAGTG---AACGGGGTTCAGTCTGGCTCAGAAGCAAGGGGATGCCAGTTTTCATATGCTGG
N--S--V--N--S--N--M--G--T--G--T--F--G--P--V-----N--G--V--Q--S--G--S--E--A--R--G--C--Q--F--S--Y--A--G

----------------------------------------------------------------------------------------------------
--R--S--N--G--R--G--L--I--N--P--Q--L--Q--G--T--A--S--N--Q--T--V--M--T--T--I--S--N--G--R--D--P--R--R-
CAGAAGCAATGGCCGGGGACTTATAAATCCACAACTACAAGGAACAGCTAGTAATCAAACAGTGATGACCACAATAAGTAATGGCAGGGACCCTCGGAGA
.:::::::::::::::::::.::::::::::::::::: ::::.::::::.::::::.::::: :::::::::::::::::::::::::::::: :.:::
TAGAAGCAATGGCCGGGGACCTATAAATCCACAACTACCAGGAGCAGCTAATAATCAGACAGTCATGACCACAATAAGTAATGGCAGGGACCCTAGAAGA
--R--S--N--G--R--G--P--I--N--P--Q--L--P--G--A--A--N--N--Q--T--V--M--T--T--I--S--N--G--R--D--P--R--R-

-------------->
-A--F--K--R--*-
GCCTTTAAAAGATGA
:::::::::::::::
GCCTTTAAAAGATGA
-A--F--K--R--*-

Pig Consensus Sequence

>BGISUST0000899433
ATGAACGGGGTCAACGACCCCCCTCTTTTTATAAAAGATATTAAGCCCGGACTGAAAAACTTAAATGTCGTCTTTATTGTCTTGGAGATA---CGCGTGA
CCAAAACCAAAGACGGCCATGAAGTGAGATCATGCAAAGTAGCAGATAAAACGGGCAGCATCACTATTTCCGTGTGGGATGAAATCGGAGGTCTCATTCA
GCCGGGGGATATTATTCGGTTGACCAGA---TATGCATCCATGTGGAAAGGATGTCTGACACTTTATACTGGAAGGGGTGGAGAACTTCAAAAAATTGGG
---TTTTGTATGGTTTATTCAGAAGTGCCAAATTTCAGTGAACCTAACCCAGATTATCGAGGACAACAAAACAAAGGGGCACATAGTGAACAGAAGAATA
ATTCTGTGAATAGTAATATGGGTACAGGTACATTTGGACCAGTG---AACGGGGTTCAGTCTGGCTCAGAAGCAAGGGGATGCCAGTTTTCATATGCTGG
TAGAAGCAATGGCCGGGGACCTATAAATCCACAACTACCAGGAGCAGCTAATAATCAGACAGTCATGACCACAATAAGTAATGGCAGGGACCCTAGAAGA
GCCTTTAAAAGATGA


>BGISUSP0000899433
MNGVNDPPLFIKDIKPGLKNLNVVFIVLEI-RVTKTKDGHEVRSCKVADKTGSITISVWDEIGGLIQPGDIIRLTR-YASMWKGCLTLYTGRGGELQKIG
-FCMVYSEVPNFSEPNPDYRGQQNKGAHSEQKNNSVNSNMGTGTFGPV-NGVQSGSEARGCQFSYAGRSNGRGPINPQLPGAANNQTVMTTISNGRDPRR
AFKR*