Sequences
EST Library Info
eye6Foetus 50 days, Eye
Clusters
Oligos
SNPs

Gene ID ENSG00000174959 (click for geneview)
Transcript ID ENST00000307835(link to ensembl)
Symbol XP_499395.1
Localtion Chromosome:7:2288013:2288877:-1 band: 7p22.3
Description PREDICTED: similar to galectin-related inter-fiber protein
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<------------------------------------------------------------------------------------><-------------
-Q--S--K--A--F--C--A--G--G--L--A--P--G--W--K--L--L--V--Q--G--H--A--D--S--G--E--D--R--F--E--T--N--F--
CAGTCTAAAGCCTTCTGTGCGGGCGGCCTGGCCCCCGGCTGGAAGCTGCTGGTCCAGGGACATGCTGACTCTGGAGAGGACAGGTTCGAGACTAACTTCT
                     :: :::::::::::::::::::: :::: :::::: :::::. :::::::::::::::::   :::::::..:::::::
---------------------GGGGGCCTGGCCCCCGGCTGGAACCTGCGGGTCCA-GGACACTCTGACTCTGGAGAGGAC---TTCGAGATCAACTTCT
----------------------G--G--L--A--P--G--W--N--L--R--V--Q--G--H--S--D--S--G--E--D-----F--E--I--N--F--

-------------------------------------------------------------><-------------------------------------
L--L--E--T--G--D--I--A--F--H--I--K--P--R--F--S--S--A--T--V--G--N--A--F--Q--Y--G--R--W--G--P--E--Q--V
TGTTGGAGACGGGGGACATTGCCTTCCACATCAAGCCCCGGTTCTCCAGCGCCACTGTGGGCAATGCCTTCCAGTACGGCCGCTGGGGCCCGGAGCAGGT
:::.::::.::::::::::::.:::::::::::::::::: ::::::::::::                                               
TGTCGGAGGCGGGGGACATTGTCTTCCACATCAAGCCCCGCTTCTCCAGCGCC-----------------------------------------------
L--S--E--A--G--D--I--V--F--H--I--K--P--R--F--S--S--A------------------------------------------------

------------------------------------------><--------------------------------------------------------
--S--S--I--F--P--L--A--P--G--E--P--F--E--I--E--V--S--W--D--A--E--H--F--H--V--Y--A--P--E--H--K--V--L-
GTCTAGCATCTTCCCGCTGGCCCCGGGGGAGCCCTTTGAGATAGAGGTCAGCTGGGACGCGGAGCACTTCCACGTCTACGCCCCGGAGCACAAGGTGCTA
                                        ::.:::::::::: ::::::::::::::::::::::.:::::: :::::::::::::::.
----------------------------------------ATGGAGGTCAGCTCGGACGCGGAGCACTTCCACGTCCACGCCCAGGAGCACAAGGTGCTG
-----------------------------------------M--E--V--S--S--D--A--E--H--F--H--V--H--A--Q--E--H--K--V--L-

----------------------------------------------------------------------------------------------------
-Q--F--P--C--R--Q--R--P--L--G--A--T--T--R--V--R--V--L--S--D--H--C--L--A--Q--V--E--L--A--K--R--G--L--
CAGTTCCCATGCCGTCAGAGGCCGCTGGGCGCCACCACCAGGGTGCGCGTGCTGAGTGACCACTGCCTGGCCCAGGTGGAGCTGGCCAAGAGGGGCCTGA
:::::: : ..:::.:: :::::::::: :::::.:::: ::::::. :::::::::::::::.: ::::::::::::::::::::::.:::.:::::::
CAGTTCGCCCACCGCCACAGGCCGCTGGCCGCCATCACCCGGGTGCAGGTGCTGAGTGACCACCGGCTGGCCCAGGTGGAGCTGGCCAGGAGAGGCCTGA
-Q--F--A--H--R--H--R--P--L--A--A--I--T--R--V--Q--V--L--S--D--H--R--L--A--Q--V--E--L--A--R--R--G--L--

-----------
S--W--G--*-
GCTGGGGGTAA
::::::::   
GCTGGGGG---
S--W--G----

Pig Consensus Sequence

>BGISUST0000881787
---------------------GGGGGCCTGGCCCCCGGCTGGAACCTGCGGGTcgGACACTCTGACTCTGGAGAGGAC---TTCGAGATCAACTTCTTGT
CGGAGGCGGGGGACATTGTCTTCCACATCAAGCCCCGCTTCTCCAGCGCC--------------------------------------------------
-------------------------------------ATGGAGGTCAGCTCGGACGCGGAGCACTTCCACGTCCACGCCCAGGAGCACAAGGTGCTGCAG
TTCGCCCACCGCCACAGGCCGCTGGCCGCCATCACCCGGGTGCAGGTGCTGAGTGACCACCGGCTGGCCCAGGTGGAGCTGGCCAGGAGAGGCCTGAGCT
GGGGG---


>BGISUSP0000881787
-------GGLAPGWNLRVGHSDSGED-FEINFLSEAGDIVFHIKPRFSSA-----------------------------MEVSSDAEHFHVHAQEHKVLQ
FAHRHRPLAAITRVQVLSDHRLAQVELARRGLSWG-