Sequences
EST Library Info
eep1Foetus 50 days, epidermis
Clusters
Oligos
SNPs

Gene ID ENSG00000174327 (click for geneview)
Transcript ID ENST00000308027(link to ensembl)
Symbol SLC16A13
Localtion Chromosome:17:6880426:6884005:1 band: 17p13.1
Description monocarboxylate transporter 13
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--A--R--R--T--E--P--P--D--G--G--W--G--W--V--V--V--L--S--A--F--F--Q--S--A--L--V--F--G--V--L--R--S--
ATGGCGCGCAGGACAGAGCCCCCCGACGGGGGCTGGGGATGGGTGGTGGTGCTCTCAGCGTTCTTCCAGTCGGCGCTTGTGTTTGGGGTGCTCCGCTCCT
:::::.:..:::.: :::::::::::::::::::::::::::.:::::::::::::::::::::::::::::::::: :::::.::::::::::::::::
ATGGCACATAGGGCTGAGCCCCCCGACGGGGGCTGGGGATGGATGGTGGTGCTCTCAGCGTTCTTCCAGTCGGCGCTGGTGTTCGGGGTGCTCCGCTCCT
-M--A--H--R--A--E--P--P--D--G--G--W--G--W--M--V--V--L--S--A--F--F--Q--S--A--L--V--F--G--V--L--R--S--

--------------------------------------------------------------------------------------------------><
F--G--V--F--F--V--E--F--V--A--A--F--E--E--Q--A--A--R--V--S--W--I--A--S--I--G--I--A--V--Q--Q--F--G--S
TTGGGGTCTTCTTCGTGGAGTTTGTGGCGGCGTTTGAGGAGCAGGCAGCGCGCGTCTCCTGGATCGCCTCCATAGGAATCGCGGTGCAGCAGTTTGGGAG
:.:: ::::::::.::::::::::::::::::::::::::::::::.::::: ::::::::::::::.::::::::::::::::::::::::::.:::  
TCGGCGTCTTCTTTGTGGAGTTTGTGGCGGCGTTTGAGGAGCAGGCGGCGCGAGTCTCCTGGATCGCTTCCATAGGAATCGCGGTGCAGCAGTTCGGG--
F--G--V--F--F--V--E--F--V--A--A--F--E--E--Q--A--A--R--V--S--W--I--A--S--I--G--I--A--V--Q--Q--F--G---

----------------------------------------------------------------------------------------------------
--P--V--G--S--A--L--S--T--K--F--G--P--R--P--V--V--M--T--G--G--I--L--A--A--L--G--M--L--L--A--S--F--A-
CCCGGTAGGCAGTGCCCTGAGCACGAAGTTCGGGCCCAGGCCCGTGGTGATGACTGGAGGCATCTTGGCTGCGCTGGGGATGCTGCTCGCCTCTTTTGCT
 ::.::.::::::::::::::::::::::::::.::::::::.:::::::::.:::::::::::::::::::..:.:::::::::::::::::.::::::
-CCAGTGGGCAGTGCCCTGAGCACGAAGTTCGGACCCAGGCCTGTGGTGATGGCTGGAGGCATCTTGGCTGCATTAGGGATGCTGCTCGCCTCCTTTGCT
--P--V--G--S--A--L--S--T--K--F--G--P--R--P--V--V--M--A--G--G--I--L--A--A--L--G--M--L--L--A--S--F--A-

------------------------------------------><--------------------------------------------------------
-T--S--L--T--H--L--Y--L--S--I--G--L--L--S--G--S--G--W--A--L--T--F--A--P--T--L--A--C--L--S--C--Y--F--
ACTTCCTTGACCCACCTATACCTGAGTATTGGGTTGCTGTCAGGCTCTGGCTGGGCTTTGACCTTCGCTCCGACCCTGGCCTGCCTGTCCTGTTATTTCT
::.::.:::::::::::.:::::::::::::::.:::: :::   :::::::::::.:::::::::.::::.::::::::::::::::::.::::.::::
ACCTCTTTGACCCACCTGTACCTGAGTATTGGGCTGCTCTCA---TCTGGCTGGGCCTTGACCTTCACTCCAACCCTGGCCTGCCTGTCCCGTTACTTCT
-T--S--L--T--H--L--Y--L--S--I--G--L--L--S-----S--G--W--A--L--T--F--T--P--T--L--A--C--L--S--R--Y--F--

----------------------------------------------------------------------------------------------------
S--R--R--R--S--L--A--T--G--L--A--L--T--G--V--G--L--S--S--F--T--F--A--P--F--F--Q--W--L--L--S--H--Y--A
CTCGCCGACGATCCCTGGCCACCGGGCTGGCACTGACAGGCGTGGGCCTCTCCTCCTTCACATTTGCCCCCTTTTTCCAGTGGCTGCTCAGCCACTACGC
:::::::.::.::::::::::::::::::::.:::::.::::::::::: ::::::::..: :::::::: .:.:::::.:::::::::::::::::.::
CTCGCCGGCGGTCCCTGGCCACCGGGCTGGCGCTGACGGGCGTGGGCCTGTCCTCCTTTGCTTTTGCCCCACTCTTCCAATGGCTGCTCAGCCACTATGC
S--R--R--R--S--L--A--T--G--L--A--L--T--G--V--G--L--S--S--F--A--F--A--P--L--F--Q--W--L--L--S--H--Y--A

----------------------------------------------------------------------------------------------------
--W--R--G--S--L--L--L--V--S--A--L--S--L--H--L--V--A--C--G--A--L--L--R--P--P--S--L--A--E--D--P--A--V-
CTGGAGGGGGTCCCTGCTGCTGGTGTCTGCCCTCTCCCTCCACCTAGTGGCCTGTGGTGCTCTCCTCCGCCCACCCTCCCTGGCTGAGGACCCTGCTGTG
:::: ::::: ::::.:::::::::::::::::::::::::::.:.::::::::::::::::: ::::::::::.:::::::::::::::::::::::::
CTGGCGGGGGGCCCTACTGCTGGTGTCTGCCCTCTCCCTCCACTTGGTGGCCTGTGGTGCTCTGCTCCGCCCACTCTCCCTGGCTGAGGACCCTGCTGTG
--W--R--G--A--L--L--L--V--S--A--L--S--L--H--L--V--A--C--G--A--L--L--R--P--L--S--L--A--E--D--P--A--V-

----------------------------------------------------------------------------------------------------
-G--G--P--R--A--Q--L--T--S--L--L--H--H--G--P--F--L--R--Y--T--V--A--L--T--L--I--N--T--G--Y--F--I--P--
GGTGGTCCCAGGGCCCAACTCACCTCTCTCCTCCATCATGGCCCCTTCCTCCGTTACACTGTTGCCCTCACCCTGATCAACACTGGCTACTTCATTCCCT
:::::.:::.:::::::.::::::: .:::::::::::.::::::::::::::::::::::: ::::: :::::::::::::: :::::::::::.::.:
GGTGGCCCCGGGGCCCAGCTCACCTGCCTCCTCCATCACGGCCCCTTCCTCCGTTACACTGTGGCCCTGACCCTGATCAACACGGGCTACTTCATCCCTT
-G--G--P--G--A--Q--L--T--C--L--L--H--H--G--P--F--L--R--Y--T--V--A--L--T--L--I--N--T--G--Y--F--I--P--

----------------------------------------------------------------------------------------------------
Y--L--H--L--V--A--H--L--Q--D--L--D--W--D--P--L--P--A--A--F--L--L--S--V--V--A--I--S--D--L--V--G--R--V
ACCTCCACCTGGTGGCCCATCTCCAGGACCTGGATTGGGACCCACTACCTGCTGCCTTCCTACTCTCAGTTGTTGCTATTTCTGACCTCGTGGGGCGTGT
:. : :::::::::::::::::::.:::::::::::::::: :::: ::::::                                               
ATGTGCACCTGGTGGCCCATCTCCGGGACCTGGATTGGGACGCACTTCCTGCT-----------------------------------------------
Y--V--H--L--V--A--H--L--R--D--L--D--W--D--A--L--P--A------------------------------------------------

----------------------------------------------------------------------------------------------------
--V--S--G--W--L--G--D--A--V--P--G--P--V--T--R--L--L--M--L--W--T--T--L--T--G--V--S--L--A--L--F--P--V-
GGTCTCCGGATGGCTGGGAGATGCAGTCCCAGGGCCTGTGACACGACTCCTGATGCTCTGGACCACCTTGACTGGGGTGTCACTAGCCCTGTTCCCTGTA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-A--Q--A--P--T--A--L--V--A--L--A--V--A--Y--G--F--T--S--G--A--L--A--P--L--A--F--S--V--L--P--E--L--I--
GCTCAGGCTCCCACAGCCCTGGTGGCTCTGGCTGTGGCCTACGGCTTCACATCAGGGGCTCTGGCCCCACTGGCCTTCTCCGTGCTGCCTGAACTAATAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------------------------------------------------------------------><------------------
G--T--R--R--I--Y--C--G--L--G--L--L--Q--M--I--E--S--I--G--G--L--L--G--P--P--L--S--G--Y--L--R--D--V--T
GGACTAGAAGGATTTACTGTGGCCTGGGACTGTTGCAGATGATAGAGAGCATCGGGGGGCTGCTGGGGCCTCCTCTCTCAGGCTACCTCCGGGATGTGAC
                                                                                   :::::::::::::::::
-----------------------------------------------------------------------------------TACCTCCGGGATGTGAC
------------------------------------------------------------------------------------Y--L--R--D--V--T

----------------------------------------------------------------------------------------------------
--G--N--Y--T--A--S--F--V--V--A--G--A--F--L--L--S--G--S--G--I--L--L--T--L--P--H--F--F--C--F--S--T--T-
AGGCAACTACACGGCTTCTTTTGTGGTGGCTGGGGCCTTCCTTCTTTCAGGGAGTGGCATTCTCCTCACCCTGCCCCACTTCTTCTGCTTCTCAACTACT
::::::::::::.::::::::::::::::: ::::::::::::::: :::::::::::.::::: ::::.::::::::::::::::::::::::.:: ::
AGGCAACTACACAGCTTCTTTTGTGGTGGCGGGGGCCTTCCTTCTTGCAGGGAGTGGCGTTCTCATCACTCTGCCCCACTTCTTCTGCTTCTCAGCTCCT
--G--N--Y--T--A--S--F--V--V--A--G--A--F--L--L--A--G--S--G--V--L--I--T--L--P--H--F--F--C--F--S--A--P-

-------------------------------------------------------------------------------->
-T--S--G--P--Q--D--L--V--T--E--A--L--D--T--K--V--P--L--P--K--E--G--L--E--E--D--*-
ACCTCCGGGCCCCAGGACCTTGTAACAGAAGCACTAGATACTAAAGTTCCCCTACCCAAGGAGGGGCTGGAAGAGGACTGA
::::::..: :::::::::.:::::::::.                                                   
ACCTCCAAGGCCCAGGACCCTGTAACAGAG---------------------------------------------------
-T--S--K--A--Q--D--P--V--T--E----------------------------------------------------

Pig Consensus Sequence

>BGISUST0000885563
ATGGCACATAGGGCTGAGCCCCCCGACGGGGGCTGGGGATGGATGGTGGTGCTCTCAGCGTTCTTCCAGTCGGCGCTGGTGTTCGGGGTGCTCCGCTCCT
TCGGCGTCTTCTTTGTGGAGTTTGTGGCGGCGTTTGAGGAGCAGGCGGCGCGAGTCTCCTGGATCGCTTCCATAGGAATCGCGGTGCAGCAGTTCGGG--
-CCAGTGGGCAGTGCCCTGAGCACGAAGTTCGGACCCAGGCCTGTGGTGATGGCTGGAGGCATCTTGGCTGCATTAGGGATGCTGCTCGCCTCCTTTGCT
ACCTCTTTGACCCACCTGTACCTGAGTATTGGGCTGCTCTCA---TCTGGCTGGGCCTTGACCTTCACTCCAACCCTGGCCTGCCTGTCCCGTTACTTCT
CTCGCCGGCGGTCCCTGGCCACCGGGCTGGCGCTGACGGGCGTGGGCCTGTCCTCCTTTGCTTTTGCCCCACTCTTCCAATGGCTGCTCAGCCACTATGC
CTGGCGGGGGGCCCTACTGCTGGTGTCTGCCCTCTCCCTCCACTTGGTGGCCTGTGGTGCTCTGCTCCGCCCACTCTCCCTGGCTGAGGACCCTGCTGTG
GGTGGCCCCGGGGCCCAGCTCACCTGCCTCCTCCATCACGGCCCCTTCCTCCGTTACACTGTGGCCCTGACCCTGATCAACACGGGCTACTTCATCCCTT
ATGTGCACCTGGTGGCCCATCTCCGGGACCTGGATTGGGACGCACTTCCTGCT-----------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-----------------------------------------------------------------------------------TACCTCCGGGATGTGAC
AGGCAACTACACAGCTTCTTTTGTGGTGGCGGGGGCCTTCCTTCTTGCAGGGAGTGGCGTTCTCATCACTCTGCCCCACTTCTTCTGCTTCTCAGCTCCT
ACCTCCAAGGCCCAGGACCCTGTAACAGAG---------------------------------------------------


>BGISUSP0000885563
MAHRAEPPDGGWGWMVVLSAFFQSALVFGVLRSFGVFFVEFVAAFEEQAARVSWIASIGIAVQQFG-PVGSALSTKFGPRPVVMAGGILAALGMLLASFA
TSLTHLYLSIGLLS-SGWALTFTPTLACLSRYFSRRRSLATGLALTGVGLSSFAFAPLFQWLLSHYAWRGALLLVSALSLHLVACGALLRPLSLAEDPAV
GGPGAQLTCLLHHGPFLRYTVALTLINTGYFIPYVHLVAHLRDLDWDALPA-------------------------------------------------
-------------------------------------------------------------YLRDVTGNYTASFVVAGAFLLAGSGVLITLPHFFCFSAP
TSKAQDPVTE-----------------