Sequences
EST Library Info
jca3Joint capsule
Clusters
Oligos
SNPs

Gene ID ENSG00000175309 (click for geneview)
Transcript ID ENST00000308158(link to ensembl)
Symbol NP_699204.1
Localtion Chromosome:5:177568197:177592392:-1 band: 5q35.3
Description hypothetical protein MGC15875
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------><----------------------------------------
-M--A--A--D--Q--R--P--K--A--D--T--L--A--L--R--Q--R--L--I--S--S--S--C--R--L--F--F--P--E--D--P--V--K--
ATGGCCGCAGACCAGCGCCCGAAGGCCGACACGCTGGCCCTGAGGCAACGGCTCATCAGCTCTTCCTGCAGACTCTTTTTTCCCGAGGATCCTGTTAAGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----------------------------------------------------------------------------><---------------------
I--V--R--A--Q--G--Q--Y--M--Y--D--E--Q--G--A--E--Y--I--D--C--I--S--N--V--A--H--V--G--H--C--H--P--L--V
TTGTCCGGGCCCAAGGGCAGTACATGTACGATGAACAGGGGGCAGAATACATCGATTGCATCAGCAATGTGGCGCACGTTGGGCACTGCCACCCTCTCGT
                                                                                ::.::::::::::::::.::
--------------------------------------------------------------------------------GGACACTGCCACCCTCTTGT
---------------------------------------------------------------------------------G--H--C--H--P--L--V

----------------------------------------------------------------------------------------------------
--V--Q--A--A--H--E--Q--N--Q--V--L--N--T--N--S--R--Y--L--H--D--N--I--V--D--Y--A--Q--R--L--S--E--T--L-
GGTCCAAGCAGCACATGAGCAGAACCAGGTGCTCAACACCAACAGCCGGTACCTGCATGACAACATCGTGGACTATGCGCAGAGGCTGTCAGAGACCCTG
::::::::::::::::::.:::::::::::::::::::::::.::::: ::::::::.::::::::::::::.:::::.::.:::::.::::::::::::
GGTCCAAGCAGCACATGAACAGAACCAGGTGCTCAACACCAATAGCCGTTACCTGCACGACAACATCGTGGATTATGCACAAAGGCTATCAGAGACCCTG
--V--Q--A--A--H--E--Q--N--Q--V--L--N--T--N--S--R--Y--L--H--D--N--I--V--D--Y--A--Q--R--L--S--E--T--L-

-------------------------------------><-------------------------------------------------------------
-P--E--Q--L--C--V--F--Y--F--L--N--S--G--S--E--A--N--D--L--A--L--R--L--A--R--H--Y--T--G--H--Q--D--V--
CCGGAGCAGCTCTGTGTGTTCTATTTCCTGAATTCTGGGTCAGAAGCCAATGACCTGGCCCTGAGGCTGGCTCGCCACTACACGGGACACCAGGACGTGG
:::::: :::::::::::::.:::                                                                            
CCGGAGAAGCTCTGTGTGTTTTAT----------------------------------------------------------------------------
-P--E--K--L--C--V--F--Y-----------------------------------------------------------------------------

------------><--------------------------------------------------------------------------------------
V--V--L--D--H--A--Y--H--G--H--L--S--S--L--I--D--I--S--P--Y--K--F--R--N--L--D--G--Q--K--E--W--V--H--V
TGGTATTAGATCATGCGTATCACGGCCACCTGAGCTCCCTGATTGACATCAGTCCCTACAAGTTCCGCAACCTGGATGGCCAGAAGGAGTGGGTCCACGT
              :: ::.:::::.:::::::::::::::::.::::::::::::::::::::::::.::::::::::::::::::::::::::::.::
--------------GCCTACCACGGTCACCTGAGCTCCCTGATCGACATCAGTCCCTACAAGTTCCGCGACCTGGATGGCCAGAAGGAGTGGGTCCATGT
---------------A--Y--H--G--H--L--S--S--L--I--D--I--S--P--Y--K--F--R--D--L--D--G--Q--K--E--W--V--H--V

><--------------------------------------------------------------------------------------------------
--A--P--L--P--D--T--Y--R--G--P--Y--R--E--D--H--P--N--P--A--M--A--Y--A--N--E--V--K--R--V--V--S--S--A-
GGCACCTCTCCCAGACACCTACCGGGGCCCCTACCGGGAGGACCACCCCAACCCAGCTATGGCCTATGCCAACGAGGTGAAACGTGTGGTCAGCAGTGCA
::: ::::::::::::::::::::::: :.:::::::::.::::: :::::.::::::.:::::::.::::.:::::::                     
GGCCCCTCTCCCAGACACCTACCGGGGACTCTACCGGGAAGACCAACCCAATCCAGCTGTGGCCTACGCCAGCGAGGTG---------------------
--A--P--L--P--D--T--Y--R--G--L--Y--R--E--D--Q--P--N--P--A--V--A--Y--A--S--E--V----------------------

-----------------><---------------------------------------------------------------------------------
-Q--E--K--G--R--K--I--A--A--F--F--A--E--S--L--P--S--V--G--G--Q--I--I--P--P--A--G--Y--F--S--Q--V--A--
CAGGAGAAGGGCAGGAAGATTGCAGCCTTCTTCGCTGAGTCTCTGCCCAGTGTGGGAGGGCAGATCATTCCCCCTGCTGGCTACTTCTCCCAAGTGGCAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

><--------------------------------------------------------------------------------------------------
E--H--I--R--K--A--G--G--V--F--V--A--D--E--I--Q--V--G--F--G--R--V--G--K--H--F--W--A--F--Q--L--Q--G--K
AGCACATCCGCAAGGCCGGAGGGGTCTTTGTTGCAGATGAGATCCAGGTTGGCTTTGGCCGGGTAGGCAAGCACTTCTGGGCCTTCCAGCTCCAGGGAAA
                 ::::::::::::::::::::::::::.::.:: :::::::::::.::.:::::::::::::::::::::::::: :::::..:
-----------------GGAGGGGTCTTTGTTGCAGATGAGATTCAAGTGGGCTTTGGCCGAGTGGGCAAGCACTTCTGGGCCTTCCAGCTGCAGGGGGA
------------------G--G--V--F--V--A--D--E--I--Q--V--G--F--G--R--V--G--K--H--F--W--A--F--Q--L--Q--G--E

----------------------------------------------------------------------------------------------------
--D--F--V--P--D--I--V--T--M--G--K--S--I--G--N--G--H--P--V--A--C--V--A--A--T--Q--P--V--A--R--A--F--E-
AGACTTCGTCCCTGACATCGTCACCATGGGCAAGTCCATTGGCAACGGCCACCCTGTTGCCTGCGTGGCCGCAACCCAGCCTGTGGCGAGGGCATTTGAA
::::::.:::::.:::::.::::::::::::::::::::::::::.::::::::::: ::::::::::::.:::::::. ::::.::.::::::::::::
AGACTTTGTCCCCGACATTGTCACCATGGGCAAGTCCATTGGCAATGGCCACCCTGTGGCCTGCGTGGCCACAACCCAAGCTGTAGCAAGGGCATTTGAA
--D--F--V--P--D--I--V--T--M--G--K--S--I--G--N--G--H--P--V--A--C--V--A--T--T--Q--A--V--A--R--A--F--E-

--------------------------><------------------------------------------------------------------------
-A--T--G--V--E--Y--F--N--T--F--G--G--S--P--V--S--C--A--V--G--L--A--V--L--N--V--L--E--K--E--Q--L--Q--
GCCACCGGCGTTGAGTACTTCAACACGTTTGGGGGCAGCCCAGTGTCCTGCGCTGTGGGGCTGGCCGTCCTGAATGTCTTGGAGAAGGAGCAGCTCCAGG
:::::::::::.::::::::::::::::::::.:::::::::::::::::.::::::::::::::.::::::.:.:::::::::::::::::::: ::::
GCCACCGGCGTCGAGTACTTCAACACGTTTGGAGGCAGCCCAGTGTCCTGTGCTGTGGGGCTGGCTGTCCTGGACGTCTTGGAGAAGGAGCAGCTGCAGG
-A--T--G--V--E--Y--F--N--T--F--G--G--S--P--V--S--C--A--V--G--L--A--V--L--D--V--L--E--K--E--Q--L--Q--

---------------------------------------------------------------------------------><-----------------
D--H--A--T--S--V--G--S--F--L--M--Q--L--L--G--Q--Q--K--I--K--H--P--I--V--G--D--V--R--G--V--G--L--F--I
ATCATGCCACCAGTGTAGGCAGCTTCCTGATGCAGCTCCTCGGGCAGCAAAAAATCAAACATCCCATCGTCGGGGATGTCAGGGGTGTTGGGCTCTTCAT
 :::.:::.:: ::::.::::::::.:: ::: ::::::: .:::::::.:::..::::::::::::: ::::.:::.::   ::.::::::::::::::
CTCACGCCGCCTGTGTGGGCAGCTTTCTCATGGAGCTCCTGAGGCAGCAGAAAGCCAAACATCCCATCCTCGGAGATATC---GGCGTTGGGCTCTTCAT
A--H--A--A--C--V--G--S--F--L--M--E--L--L--R--Q--Q--K--A--K--H--P--I--L--G--D--I-----G--V--G--L--F--I

-----------------------------------------------------------------------><---------------------------
--G--V--D--L--I--K--D--E--A--T--R--T--P--A--T--E--E--A--A--Y--L--V--S--R--L--K--E--N--Y--V--L--L--S-
TGGTGTGGATCTGATCAAAGATGAGGCCACAAGGACACCAGCAACTGAAGAGGCTGCCTACTTGGTATCAAGGCTGAAGGAGAACTACGTTTTGCTGAGC
::::::::::::::::::::::::::::::.::::..::::::::.:::::::::: :::: ::::.      .::::::::::::::.::: :.:::::
TGGTGTGGATCTGATCAAAGATGAGGCCACGAGGATGCCAGCAACCGAAGAGGCTGACTACGTGGTG------TTGAAGGAGAACTACATTTGGTTGAGC
--G--V--D--L--I--K--D--E--A--T--R--M--P--A--T--E--E--A--D--Y--V--V--------L--K--E--N--Y--I--W--L--S-

----------------------------------------------------------------------------------------------------
-T--D--G--P--G--R--N--I--L--K--F--K--P--P--M--C--F--S--L--D--N--A--R--Q--V--V--A--K--L--D--A--I--L--
ACTGATGGCCCTGGGAGGAACATCCTGAAGTTTAAGCCCCCAATGTGCTTCAGCCTGGACAATGCACGGCAGGTGGTGGCAAAGCTGGATGCCATTCTGA
::.::::::::.::::::::..::::::::::::::::::::::::::::::::. ::::::.:::::.:: :::::.:::::::::::..::::.::: 
ACCGATGGCCCCGGGAGGAATGTCCTGAAGTTTAAGCCCCCAATGTGCTTCAGCTGGGACAACGCACGACACGTGGTAGCAAAGCTGGACACCATCCTG-
-T--D--G--P--G--R--N--V--L--K--F--K--P--P--M--C--F--S--W--D--N--A--R--H--V--V--A--K--L--D--T--I--L--

--><------------------------------------------------>
T--D--M--E--E--K--V--R--S--C--E--T--L--R--L--Q--P--*-
CTGACATGGAAGAGAAGGTGAGAAGTTGTGAAACGCTGAGGCTCCAGCCCTAA
                                                     
-----------------------------------------------------
-----------------------------------------------------

Pig Consensus Sequence

>BGISUST0000889419
----------------------------------------------------------------------------------------------------
--------------------------------------------------------------------------------GGACACTGCCACCCTCTTGT
GGTCCAAGCAGCACATGAACAGAACCAGGTGCTCAACACCAATAGCCGTTACCTGCACGACAACATCGTGGATTATGCACAAAGGCTATCAGAGACCCTG
CCGGAGAAGCTCTGTGTGTTTTAT----------------------------------------------------------------------------
--------------GCCTACCACGGTCACCTGAGCTCCCTGATCGACATCAGTCCCTACAAGTTCCGCGACCTGGATGGCCAGAAGGAGTGGGTCCATGT
GGCCCCTCTCCCAGACACCTACCGGGGACTCTACCGGGAAGACCAACCCAATCCAGCTGTGGCCTACGCCAGCGAGGTG---------------------
----------------------------------------------------------------------------------------------------
-----------------GGAGGGGTCTTTGTTGCAGATGAGATTCAAGTGGGCTTTGGCCGAGTGGGCAAGCACTTCTGGGCCTTCCAGCTGCAGGGGGA
AGACTTTGTCCCCGACATTGTCACCATGGGCAAGTCCATTGGCAATGGCCACCCTGTGGCCTGCGTGGCCACAACCCAAGCTGTAGCAAGGGCATTTGAA
GCCACCGGCGTCGAGTACTTCAACACGTTTGGAGGCAGCCCAGTGTCCTGTGCTGTGGGGCTGGCTGTCCTGGACGTCTTGGAGAAGGAGCAGCTGCAGG
CTCACGCCGCCTGTGTGGGCAGCTTTCTCATGGAGCTCCTGAGGCAGCAGAAAGCCAAACATCCCATCCTCGGAGATATC---GGCGTTGGGCTCTTCAT
TGGTGTGGATCTGATCAAAGATGAGGCCACGAGGATGCCAGCAACCGAAGAGGCTGACTACGTGGTG------TTGAAGGAGAACTACATTTGGTTGAGC
ACCGATGGCCCCGGGAGGAATGTCCTGAAGTTTAAGCCCCCAATGTGCTTCAGCTGGGACAACGCACGACACGTGGTAGCAAAGCTGGACACCATCCTG-
-----------------------------------------------------


>BGISUSP0000889419
------------------------------------------------------------GHCHPLVVQAAHEQNQVLNTNSRYLHDNIVDYAQRLSETL
PEKLCVFY------------------------------AYHGHLSSLIDISPYKFRDLDGQKEWVHVAPLPDTYRGLYREDQPNPAVAYASEV-------
---------------------------------------GGVFVADEIQVGFGRVGKHFWAFQLQGEDFVPDIVTMGKSIGNGHPVACVATTQAVARAFE
ATGVEYFNTFGGSPVSCAVGLAVLDVLEKEQLQAHAACVGSFLMELLRQQKAKHPILGDI-GVGLFIGVDLIKDEATRMPATEEADYVV--LKENYIWLS
TDGPGRNVLKFKPPMCFSWDNARHVVAKLDTIL------------------