Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000175325 (click for geneview)
Transcript ID ENST00000308304(link to ensembl)
Symbol PROP1
Localtion Chromosome:5:177351842:177355849:-1 band: 5q35.3
Description Homeobox protein prophet of Pit-1 (PROP-1) (Pituitary specific homeodomain factor). [Source:Uniprot/SWISSPROT;Acc:O75360]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--E--A--E--R--R--R--Q--A--E--K--P--K--K--G--R--V--G--S--N--L--L--P--E--R--H--P--A--T--G--T--P--T--
ATGGAAGCAGAAAGGAGGCGCCAGGCTGAGAAGCCAAAGAAGGGGCGAGTCGGCAGCAACCTGTTGCCTGAGAGACACCCGGCCACTGGGACCCCGACCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------><------------------------------------------------------------------------------------------
T--T--V--D--S--S--A--P--P--C--R--R--L--P--G--A--G--G--G--R--S--R--F--S--P--Q--G--G--Q--R--G--R--P--H
CCACGGTGGACTCGAGTGCTCCACCCTGCAGAAGGCTCCCTGGTGCAGGAGGGGGGAGATCAAGGTTCTCCCCGCAAGGAGGACAGAGGGGCCGCCCGCA
            ..::..::: :::::.:::::. :::.::::.:.:::::  ::::::.:: ::.:.:::::::::::::::::::::::.::::: ::
-----------ATAAGCACTCGACCCTACAGAAACCTCTCTGGCGTAGGAGCCGGGAGACCACGGCTTTCCCCGCAAGGAGGACAGAGGGGTCGCCCCCA
------------I--S--T--R--P--Y--R--N--L--S--G--V--G--A--G--R--P--R--L--S--P--Q--G--G--Q--R--G--R--P--H

----------------------------------------------------------------------------------------------------
--S--R--R--R--H--R--T--T--F--S--P--V--Q--L--E--Q--L--E--S--A--F--G--R--N--Q--Y--P--D--I--W--A--R--E-
CTCCCGGCGCCGCCACCGCACCACCTTCAGCCCAGTGCAGTTGGAACAGCTGGAGTCAGCCTTTGGGAGGAACCAGTACCCCGACATCTGGGCCCGAGAG
::::::::::::::::::::::::::::::.::::.:::::::::::::::::::::::::::::::::::::::::::::.:::::.::::::::::::
CTCCCGGCGCCGCCACCGCACCACCTTCAGTCCAGCGCAGTTGGAACAGCTGGAGTCAGCCTTTGGGAGGAACCAGTACCCTGACATTTGGGCCCGAGAG
--S--R--R--R--H--R--T--T--F--S--P--A--Q--L--E--Q--L--E--S--A--F--G--R--N--Q--Y--P--D--I--W--A--R--E-

-----------------------------------------><---------------------------------------------------------
-S--L--A--R--D--T--G--L--S--E--A--R--I--Q--V--W--F--Q--N--R--R--A--K--Q--R--K--Q--E--R--S--L--L--Q--
AGTCTTGCCCGGGACACTGGCCTCAGTGAGGCCCGAATCCAGGTCTGGTTCCAGAACCGCAGAGCTAAGCAACGGAAGCAAGAGCGCTCACTGCTTCAGC
.:.::.::: ::::::: :: :::::::::::: :::::::::::::::::::::::::::::::::::::. ::::::::::::: ::::::::.::::
GGCCTCGCCAGGGACACAGGACTCAGTGAGGCCAGAATCCAGGTCTGGTTCCAGAACCGCAGAGCTAAGCAGAGGAAGCAAGAGCGGTCACTGCTCCAGC
-G--L--A--R--D--T--G--L--S--E--A--R--I--Q--V--W--F--Q--N--R--R--A--K--Q--R--K--Q--E--R--S--L--L--Q--

----------------------------------------------------------------------------------------------------
P--L--A--H--L--S--P--A--A--F--S--S--F--L--P--E--S--T--A--C--P--Y--S--Y--A--A--P--P--P--P--V--T--C--F
CTCTGGCCCATCTGTCTCCTGCCGCCTTTTCCAGCTTCTTGCCAGAGTCCACTGCTTGCCCCTATTCTTACGCAGCACCACCACCACCAGTGACCTGCTT
: ::::::::.::::::::::::.::::.:::.:.:::::::: :::.:: :.:::::::::::.::.::: ::.:.::: : ::::::.::::::::::
CACTGGCCCACCTGTCTCCTGCCACCTTCTCCGGTTTCTTGCCCGAGCCCCCCGCTTGCCCCTACTCCTACCCAACGCCAACCCCACCAATGACCTGCTT
P--L--A--H--L--S--P--A--T--F--S--G--F--L--P--E--P--P--A--C--P--Y--S--Y--P--T--P--T--P--P--M--T--C--F

----------------------------------------------------------------------------------------------------
--P--H--P--Y--S--H--A--L--P--S--Q--P--S--T--G--G--A--F--A--L--S--H--Q--S--E--D--W--Y--P--T--L--H--P-
CCCTCACCCCTACAGCCATGCCCTCCCTTCCCAGCCCTCCACAGGAGGCGCCTTTGCTTTGTCACACCAGTCTGAGGACTGGTACCCTACCTTGCACCCA
::::::::::::::..::::::::.::.::.:::::::::::.:: ::: ::::::::. ..  : :::::::::.::::::::.::.::::::::::::
CCCTCACCCCTACAATCATGCCCTTCCCTCTCAGCCCTCCACGGGTGGCTCCTTTGCTCGACACCCCCAGTCTGAAGACTGGTATCCCACCTTGCACCCA
--P--H--P--Y--N--H--A--L--P--S--Q--P--S--T--G--G--S--F--A--R--H--P--Q--S--E--D--W--Y--P--T--L--H--P-

-------------------------------------------------------------------------------->
-A--P--A--G--H--L--P--C--P--P--P--P--P--M--L--P--L--S--L--E--P--S--K--S--W--N--*-
GCCCCTGCCGGCCATCTGCCCTGCCCCCCACCCCCTCCCATGCTCCCCCTCAGCCTTGAGCCATCCAAGTCCTGGAACTGA
.::::..: ::.:::::::::::::::::: :::: ::..::::.::::::::::::::::::.: :::::::::.:::.:
ACCCCCACGGGTCATCTGCCCTGCCCCCCAGCCCCACCTGTGCTTCCCCTCAGCCTTGAGCCACCAAAGTCCTGGGACTAA
-T--P--T--G--H--L--P--C--P--P--A--P--P--V--L--P--L--S--L--E--P--P--K--S--W--D--*-

Pig Consensus Sequence

>BGISUST0000877405
----------------------------------------------------------------------------------------------------
-----------ATAAGCACTCGACCCTACAGAAACCTCTCTGGCGTAGGAGCCGGGAGACCACGGCTTTCCCCGCAAGGAGGACAGAGGGGTCGCCCCCA
CTCCCGGCGCCGCCACCGCACCACCTTCAGTCCAGCGCAGTTGGAACAGCTGGAGTCAGCCTTTGGGAGGAACCAGTACCCTGACATTTGGGCCCGAGAG
GGCCTCGCCAGGGACACAGGACTCAGTGAGGCCAGAATCCAGGTCTGGTTCCAGAACCGCAGAGCTAAGCAGAGGAAGCAAGAGCGGTCACTGCTCCAGC
CACTGGCCCACCTGTCTCCTGCCACCTTCTCCGGTTTCTTGCCCGAGCCCCCCGCTTGCCCCTACTCCTACCCAACGCCAACCCCACCAATGACCTGCTT
CCCTCACCCCTACAATCATGCCCTTCCCTCTCAGCCCTCCACGGGTGGCTCCTTTGCTCGACACCCCCAGTCTGAAGACTGGTATCCCACCTTGCACCCA
ACCCCCACGGGTCATCTGCCCTGCCCCCCAGCCCCACCTGTGCTTCCCCTCAGCCTTGAGCCACCAAAGTCCTGGGACTAA


>BGISUSP0000877405
-------------------------------------ISTRPYRNLSGVGAGRPRLSPQGGQRGRPHSRRRHRTTFSPAQLEQLESAFGRNQYPDIWARE
GLARDTGLSEARIQVWFQNRRAKQRKQERSLLQPLAHLSPATFSGFLPEPPACPYSYPTPTPPMTCFPHPYNHALPSQPSTGGSFARHPQSEDWYPTLHP
TPTGHLPCPPAPPVLPLSLEPPKSWD*