Sequences
EST Library Info
nmm2Newborn 115 days, mucosal membranes
Clusters
Oligos
SNPs

Gene ID ENSG00000073067 (click for geneview)
Transcript ID ENST00000308919(link to ensembl)
Symbol CYP2W1
Localtion Chromosome:7:796076:802517:1 band: 7p22.3
Description Cytochrome P450 2W1 (EC 1.14.14.-) (CYPIIW1). [Source:Uniprot/SWISSPROT;Acc:Q8TAV3]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--A--L--L--L--L--L--F--L--G--L--L--G--L--W--G--L--L--C--A--C--A--Q--D--P--S--P--A--A--R--W--P--P--
ATGGCCCTGCTGCTCTTGCTGTTCCTGGGCCTCCTGGGGCTCTGGGGGCTGCTCTGCGCCTGCGCCCAAGACCCCTCCCCAGCTGCCCGGTGGCCCCCGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------------------------------------------------------><-------------------------
G--P--R--P--L--P--L--V--G--N--L--H--L--L--R--L--S--Q--Q--D--R--S--L--M--E--L--S--E--R--Y--G--P--V--F
GGCCTCGCCCGCTGCCGCTCGTCGGGAACCTGCACTTGCTGCGTCTGTCGCAACAGGACCGGTCCCTGATGGAGCTCTCAGAACGCTACGGGCCGGTGTT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--T--V--H--L--G--R--Q--K--T--V--V--L--T--G--F--E--A--V--K--E--A--L--A--G--P--G--Q--E--L--A--D--R--P-
CACCGTGCACCTGGGGCGCCAGAAGACGGTGGTGCTGACGGGGTTCGAGGCGGTCAAAGAGGCGCTGGCGGGCCCCGGGCAGGAGCTGGCCGACCGGCCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------------------------------><--------------------------------------------------------------
-P--I--A--I--F--Q--L--I--Q--R--G--G--G--I--F--F--S--S--G--A--R--W--R--A--A--R--Q--F--T--V--R--A--L--
CCCATCGCCATCTTCCAGCTCATCCAGCGAGGTGGAGGCATCTTCTTCTCATCTGGGGCGCGCTGGAGGGCTGCCCGCCAGTTCACGGTGCGTGCCCTGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------------------------------------------------------------------------><------------
H--S--L--G--V--G--R--E--P--V--A--D--K--I--L--Q--E--L--K--C--L--S--G--Q--L--D--G--Y--R--G--R--P--F--P
ACAGCCTGGGCGTGGGCCGGGAGCCGGTGGCTGACAAGATTCTGCAGGAGCTGAAATGCCTCTCTGGGCAGCTGGATGGCTACAGAGGCCGGCCCTTCCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--L--A--L--L--G--W--A--P--S--N--I--T--F--A--L--L--F--G--R--R--F--D--Y--R--D--P--V--F--V--S--L--L--G-
GCTGGCCCTACTGGGCTGGGCTCCCTCCAATATCACCTTCGCGCTCCTCTTCGGCCGCCGATTTGACTACCGGGACCCCGTGTTTGTGTCCCTGCTGGGT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------------------------------><------------------------------------------------------
-L--I--D--E--V--M--V--L--L--G--S--P--G--L--Q--L--F--N--V--Y--P--W--L--G--A--L--L--Q--L--H--R--P--V--
CTCATCGATGAGGTCATGGTCCTCTTGGGGTCCCCTGGCCTGCAGCTGTTCAACGTCTACCCATGGCTCGGGGCCCTGCTCCAGCTGCACCGGCCCGTCC
                                             :::::::::.:::.::: :::::::::::::: ::::::::::::::.::::::.
---------------------------------------------CTGTTCAACATCTGCCCCTGGCTCGGGGCCCTCCTCCAGCTGCACCGACCCGTCT
----------------------------------------------L--F--N--I--C--P--W--L--G--A--L--L--Q--L--H--R--P--V--

----------------------------------------------------------------------------------------------------
L--R--K--I--E--E--V--R--A--I--L--R--T--L--L--E--A--R--R--P--H--V--C--P--G--D--P--V--C--S--Y--V--D--A
TGCGCAAGATCGAGGAGGTCCGTGCCATTCTGAGGACCCTCCTGGAGGCGCGGAGGCCCCACGTGTGCCCGGGGGACCCCGTGTGCAGCTATGTGGACGC
:::::::::::::: :::: :: ::: ::::: :::::::::::::::::::: :::::::: .:. :    ..:. : .:::.. :::::. :::::::
TGCGCAAGATCGAGCAGGTGCGGGCCCTTCTGCGGACCCTCCTGGAGGCGCGGCGGCCCCACCCGCCCAGCCAAGGACGTGTGCAGAGCTACCTGGACGC
L--R--K--I--E--Q--V--R--A--L--L--R--T--L--L--E--A--R--R--P--H--P--P--S--Q--G--R--V--Q--S--Y--L--D--A

------------------><--------------------------------------------------------------------------------
--L--I--Q--Q--G--Q--G--D--D--P--E--G--L--F--A--E--A--N--A--V--A--C--T--L--D--M--V--M--A--G--T--E--T-
CCTGATCCAGCAGGGACAGGGGGATGACCCCGAGGGCCTGTTTGCTGAGGCCAACGCGGTGGCCTGCACCCTGGACATGGTCATGGCCGGGACGGAGACG
::::::::::::.:: ::::::.: ::::::::::::::::::::.:::: :::::.::::::::::::::::::::::                     
CCTGATCCAGCAAGGCCAGGGGAAAGACCCCGAGGGCCTGTTTGCCGAGGACAACGTGGTGGCCTGCACCCTGGACATG---------------------
--L--I--Q--Q--G--Q--G--K--D--P--E--G--L--F--A--E--D--N--V--V--A--C--T--L--D--M----------------------

---------------------------------------------------------><-----------------------------------------
-T--S--A--T--L--Q--W--A--A--L--L--M--G--R--H--P--D--V--Q--G--R--V--Q--E--E--L--D--R--V--L--G--P--G--
ACCTCGGCCACGCTGCAGTGGGCCGCACTTCTGATGGGCCGGCACCCGGACGTGCAGGGCCGGGTGCAGGAGGAGCTAGACCGCGTGCTGGGCCCTGGGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
R--T--P--R--L--E--D--Q--Q--A--L--P--Y--T--S--A--V--L--H--E--V--Q--R--F--I--T--L--L--P--H--V--P--R--C
GGACTCCCCGGCTGGAGGACCAGCAGGCTCTGCCCTACACAAGCGCCGTGCTCCACGAGGTGCAGCGGTTCATCACGCTCCTGCCGCACGTGCCCCGCTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------------------------------------><--------------------------------------------------------
--T--A--A--D--T--Q--L--G--G--F--L--L--P--K--G--T--P--V--I--P--L--L--T--S--V--L--L--D--E--T--Q--W--Q-
CACCGCGGCCGACACACAGCTGGGCGGCTTCCTGCTCCCCAAGGGCACGCCCGTGATTCCCCTGCTGACCTCGGTGCTCCTGGATGAGACACAGTGGCAG
                                                                                        ::.:::::: ::
----------------------------------------------------------------------------------------ACGCAGTGGGAG
-----------------------------------------------------------------------------------------T--Q--W--E-

------------------------------------------------------------------------------------------------><--
----T--P--G--Q--F--N--P-----G--H--F--L-----D--A--N--G--H--F--V--K--R-----E--A--F--L--P--F--S--A--G--
---ACCCCAGGCCAGTTCAACCCC---GGCCATTTCCTG---GACGCGAATGGGCACTTTGTGAAGCGG---GAGGCCTTCCTGCCTTTCTCTGCAGGCC
   :: ::. ::::::::::::::    ::::.::::::     ::: .:::::..: :.::::::::    : :::::::::::::::::::      :
G--ACGCCGCGCCAGTTCAACCCCG--TGCCACTTCCTGG--CCCGCCGATGGGTGCGTCGTGAAGCGTG--GCGGCCTTCCTGCCTTTCTCT------C
-\--T--P--R--Q--F--N--P--\--G--H--F--L--\--P--A--D--G--C--V--V--K--R--\--A--A--F--L--P--F--S--------

----------------------------------------------------------------------------------------------------
R--R--V--C--V--G--E--R--L--A--R--T--E--L--F--L--L--F--A--G--L--L--Q--R--Y--R--L--L--P--P--P--G--V--S
GCCGCGTCTGTGTTGGGGAGCGCCTGGCCAGGACCGAGCTCTTCCTGCTGTTTGCCGGCCTCCTGCAGAGGTACCGCCTGCTGCCCCCGCCTGGCGTCAG
::::::::::::: :::::: ::::::: ::: :::::::::::::::::::::: ::::::::::::::.::::::::::::::::::::.::  ::::
GCCGCGTCTGTGTGGGGGAGAGCCTGGCAAGGTCCGAGCTCTTCCTGCTGTTTGCGGGCCTCCTGCAGAGATACCGCCTGCTGCCCCCGCCCGGGCTCAG
R--R--V--C--V--G--E--S--L--A--R--S--E--L--F--L--L--F--A--G--L--L--Q--R--Y--R--L--L--P--P--P--G--L--S

------------------------------------------------------------------------------------>
--P--A--S--L--D--T--T--P--A--R--A--F--T--M--R--P--R--A--Q--A--L--C--A--V--P--R--P--*-
TCCGGCCTCCCTGGACACCACGCCCGCCCGGGCTTTTACCATGAGGCCGAGGGCCCAGGCCCTGTGTGCGGTGCCCAGGCCCTAG
.:: ::: :::::::::::::::::.::: :::.::.:::::: ::::.  .::::::::::::::.:: :::::::::      
CCCCGCCACCCTGGACACCACGCCCACCCCGGCCTTCACCATGCGGCCACCAGCCCAGGCCCTGTGCGCCGTGCCCAGG------
--P--A--T--L--D--T--T--P--T--P--A--F--T--M--R--P--P--A--Q--A--L--C--A--V--P--R-------

Pig Consensus Sequence

>BGISUST0000885185
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
---------------------------------------------CTGTTCAACATCTGCCCCTGGCTCGGGGCCCTCCTCCAGCTGCACCGACCCGTCT
TGCGCAAGATCGAGCAGGTGCGGGCCCTTCTGCGGACCCTCCTGGAGGCGCGGCGGCCCCACCCGCCCAGCCAAGGACGTGTGCAGAGCTACCTGGACGC
CCTGATCCAGCAAGGCCAGGGGAAAGACCCCGAGGGCCTGTTTGCCGAGGACAACGTGGTGGCCTGCACCCTGGACATG---------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------ACGCAGTGGGAg
aCGCCGCGCCAGTTCAACCCctGCCACTTCCTgcCCGCCGATGGGTGCGTCGTGAAGCGtgCGGCCTTCCTGCCTTTCTCT------CGCCGCGTCTGTG
TGGGGGAGAGCCTGGCAAGGTCCGAGCTCTTCCTGCTGTTTGCGGGCCTCCTGCAGAGATACCGCCTGCTGCCCCCGCCCGGGCTCAGCCCCGCCACCCT
GGACACCACGCCCACCCCGGCCTTCACCATGCGGCCACCAGCCCAGGCCCTGTGCGCCGTGCCCAGG------


>BGISUSP0000885185
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
---------------LFNICPWLGALLQLHRPVLRKIEQVRALLRTLLEARRPHPPSQGRVQSYLDALIQQGQGKDPEGLFAEDNVVACTLDM-------
------------------------------------------------------------------------------------------------TQWE
TPRQFNPCHFLPADGCVVKRAAFLPFS--RRVCVGESLARSELFLLFAGLLQRYRLLPPPGLSPATLDTTPTPAFTMRPPAQALCAVPR--