Sequences
EST Library Info
cbl1Blood
plac1Unavailable
pldo1Unavailable
ste1M. Semitendinosus
Clusters
Oligos
SNPs

Gene ID ENSG00000174125 (click for geneview)
Transcript ID ENST00000308979(link to ensembl)
Symbol TLR1
Localtion Chromosome:4:38620444:38628978:-1 band: 4p14
Description Toll-like receptor 1 precursor (Toll/interleukin-1 receptor-like protein) (TIL) (CD281 antigen). [Source:Uniprot/SWISSPROT;Acc:Q15399]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--T--S--I--F--H--F--A--I--I--F--M--L--I--L--Q--I--R--I--Q--L--S--E--E--S--E--F--L--V--D--R--S--K--
ATGACTAGCATCTTCCATTTTGCCATTATCTTCATGTTAATACTTCAGATCAGAATACAATTATCTGAAGAAAGTGAATTTTTAGTTGATAGGTCAAAAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
N--G--L--I--H--V--P--K--D--L--S--Q--K--T--T--I--L--N--I--S--Q--N--Y--I--S--E--L--W--T--S--D--I--L--S
ACGGTCTCATCCACGTTCCTAAAGACCTATCCCAGAAAACAACAATCTTAAATATATCGCAAAATTATATATCTGAGCTTTGGACTTCTGACATCTTATC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--L--S--K--L--R--I--L--I--I--S--H--N--R--I--Q--Y--L--D--I--S--V--F--K--F--N--Q--E--L--E--Y--L--D--L-
ACTGTCAAAACTGAGGATTTTGATAATTTCTCATAATAGAATCCAGTATCTTGATATCAGTGTTTTCAAATTCAACCAGGAATTGGAATACTTGGATTTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-S--H--N--K--L--V--K--I--S--C--H--P--T--V--N--L--K--H--L--D--L--S--F--N--A--F--D--A--L--P--I--C--K--
TCCCACAACAAGTTGGTGAAGATTTCTTGCCACCCTACTGTGAACCTCAAGCACTTGGACCTGTCATTTAATGCATTTGATGCCCTGCCTATATGCAAAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
E--F--G--N--M--S--Q--L--K--F--L--G--L--S--T--T--H--L--E--K--S--S--V--L--P--I--A--H--L--N--I--S--K--V
AGTTTGGCAATATGTCTCAACTAAAATTTCTGGGGTTGAGCACCACACACTTAGAAAAATCTAGTGTGCTGCCAATTGCTCATTTGAATATCAGCAAGGT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--L--L--V--L--G--E--T--Y--G--E--K--E--D--P--E--G--L--Q--D--F--N--T--E--S--L--H--I--V--F--P--T--N--K-
CTTGCTGGTCTTAGGAGAGACTTATGGGGAAAAAGAAGACCCTGAGGGCCTTCAAGACTTTAACACTGAGAGTCTGCACATTGTGTTCCCCACAAACAAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-E--F--H--F--I--L--D--V--S--V--K--T--V--A--N--L--E--L--S--N--I--K--C--V--L--E--D--N--K--C--S--Y--F--
GAATTCCATTTTATTTTGGATGTGTCAGTCAAGACTGTAGCAAATCTGGAACTATCTAATATCAAATGTGTGCTAGAAGATAACAAATGTTCTTACTTCC
               :::::.::::::::::. ::.:.::.::::::::::::.::.:::::::.:::::::::.:: : ::::..::::. :.::::::
---------------TTGGACGTGTCAGTCAGCACCGCAGTAAATCTGGAACTGTCCAATATCAGATGTGTGCTGGATGCTAACGGATGTCATCACTTCC
----------------L--D--V--S--V--S--T--A--V--N--L--E--L--S--N--I--R--C--V--L--D--A--N--G--C--H--H--F--

----------------------------------------------------------------------------------------------------
L--S--I--L--A--K--L--Q--T--N--P--K--L--S--N--L--T--L--N--N--I--E--T--T--W--N--S--F--I--R--I--L--Q--L
TAAGTATTCTGGCGAAACTTCAAACAAATCCAAAGTTATCAAATCTTACCTTAAACAACATTGAAACAACTTGGAATTCTTTCATTAGGATCCTCCAGCT
 ::.:.::::. .::::::::::: .::..:::::::::: ::.:: ::.::.:::::::::::::: :::::::::::::::::::  :.:::::::.:
AAAATGTTCTATTGAAACTTCAAAAGAACTCAAAGTTATCCAACCTGACTTTGAACAACATTGAAACCACTTGGAATTCTTTCATTACCACCCTCCAGTT
Q--N--V--L--L--K--L--Q--K--N--S--K--L--S--N--L--T--L--N--N--I--E--T--T--W--N--S--F--I--T--T--L--Q--F

----------------------------------------------------------------------------------------------------
--V--W--H--T--T--V--W--Y--F--S--I--S--N--V--K--L--Q--G--Q--L--D--F--R--D--F--D--Y--S--G--T--S--L--K-
GGTTTGGCATACAACTGTATGGTATTTCTCAATTTCAAACGTGAAGCTACAGGGTCAGCTGGACTTCAGAGATTTTGATTATTCTGGCACTTCCTTGAAG
 ::.:::::::::: ..:  .::::::.:: ::::: :..::.::.:::::.::::::::::::::::::::::::::::::::::.::: :: .:::::
TGTCTGGCATACAAGCATCGAGTATTTTTCCATTTCCAGTGTAAAACTACAAGGTCAGCTGGACTTCAGAGATTTTGATTATTCTGACACGTCACTGAAG
--V--W--H--T--S--I--E--Y--F--S--I--S--S--V--K--L--Q--G--Q--L--D--F--R--D--F--D--Y--S--D--T--S--L--K-

----------------------------------------------------------------------------------------------------
-A--L--S--I--H--Q--V--V--S--D--V--F--G--F--P--Q--S--Y--I--Y--E--I--F--S--N--M--N--I--K--N--F--T--V--
GCCTTGTCTATACACCAAGTTGTCAGCGATGTGTTCGGTTTTCCGCAAAGTTATATCTATGAAATCTTTTCGAATATGAACATCAAAAATTTCACAGTGT
::::::::: ::::::::::::::::.:: ::::::.::::.::.:::::::::::::::.::::::::::.:::::::::::. :. ::.:::::::::
GCCTTGTCTCTACACCAAGTTGTCAGTGAGGTGTTCAGTTTCCCACAAAGTTATATCTATAAAATCTTTTCAAATATGAACATTCAGTATCTCACAGTGT
-A--L--S--L--H--Q--V--V--S--E--V--F--S--F--P--Q--S--Y--I--Y--K--I--F--S--N--M--N--I--Q--Y--L--T--V--

----------------------------------------------------------------------------------------------------
S--G--T--R--M--V--H--M--L--C--P--S--K--I--S--P--F--L--H--L--D--F--S--N--N--L--L--T--D--T--V--F--E--N
CTGGTACACGCATGGTCCACATGCTTTGCCCATCCAAAATTAGCCCGTTCCTGCATTTGGATTTTTCCAATAATCTCTTAACAGACACGGTTTTTGAAAA
::: .::::.::::::::::::: ::::::::::: ::::::::::.::.::..:::::::::::::::::::: .:::::::::::.:::::::.::::
CTGCCACACACATGGTCCACATGGTTTGCCCATCCCAAATTAGCCCATTTCTATATTTGGATTTTTCCAATAATGCCTTAACAGACATGGTTTTTAAAAA
S--A--T--H--M--V--H--M--V--C--P--S--Q--I--S--P--F--L--Y--L--D--F--S--N--N--A--L--T--D--M--V--F--K--N

----------------------------------------------------------------------------------------------------
--C--G--H--L--T--E--L--E--T--L--I--L--Q--M--N--Q--L--K--E--L--S--K--I--A--E--M--T--T--Q--M--K--S--L-
TTGTGGGCACCTTACTGAGTTGGAGACACTTATTTTACAAATGAATCAATTAAAAGAACTTTCAAAAATAGCTGAAATGACTACACAGATGAAGTCTCTG
::::: . ::.: .::.: :::.: :::::.: :::::::::::::::.:::::::::::: ..:: .: ... : :::::.: : :.::: :::::::.
TTGTGCAAACTTGGCTAATTTGAACACACTCAGTTTACAAATGAATCAGTTAAAAGAACTTGTGAATGTCATCCATATGACCAAAGAAATGCAGTCTCTA
--C--A--N--L--A--N--L--N--T--L--S--L--Q--M--N--Q--L--K--E--L--V--N--V--I--H--M--T--K--E--M--Q--S--L-

----------------------------------------------------------------------------------------------------
-Q--Q--L--D--I--S--Q--N--S--V--S--Y--D--E--K--K--G--D--C--S--W--T--K--S--L--L--S--L--N--M--S--S--N--
CAACAATTGGATATTAGCCAGAATTCTGTAAGCTATGATGAAAAGAAAGGAGACTGTTCTTGGACTAAAAGTTTATTAAGTTTAAATATGTCTTCAAATA
::.:::::::::.::::::::::: :. :.:: ::::::::::: .:.:::...::. ::::::::..::::::::::::::::::: :.::::::::::
CAGCAATTGGATGTTAGCCAGAATACCCTGAGGTATGATGAAAATGAGGGAAGTTGCACTTGGACTGGAAGTTTATTAAGTTTAAATTTATCTTCAAATA
-Q--Q--L--D--V--S--Q--N--T--L--R--Y--D--E--N--E--G--S--C--T--W--T--G--S--L--L--S--L--N--L--S--S--N--

----------------------------------------------------------------------------------------------------
I--L--T--D--T--I--F--R--C--L--P--P--R--I--K--V--L--D--L--H--S--N--K--I--K--S--I--P--K--Q--V--V--K--L
TACTTACTGACACTATTTTCAGATGTTTACCTCCCAGGATCAAGGTACTTGATCTTCACAGCAATAAAATAAAGAGCATTCCTAAACAAGTCGTAAAACT
::::.:::::: ::.:::::::::::::::::::::::.::::::: :::::::::::::..::.:.:::::.::::::.:::::. : ::::.  : ::
TACTCACTGACTCTGTTTTCAGATGTTTACCTCCCAGGGTCAAGGTTCTTGATCTTCACAATAACAGAATAAGGAGCATCCCTAAGGATGTCGCCCATCT
I--L--T--D--S--V--F--R--C--L--P--P--R--V--K--V--L--D--L--H--N--N--R--I--R--S--I--P--K--D--V--A--H--L

----------------------------------------------------------------------------------------------------
--E--A--L--Q--E--L--N--V--A--F--N--S--L--T--D--L--P--G--C--G--S--F--S--S--L--S--V--L--I--I--D--H--N-
GGAAGCTTTGCAAGAACTCAATGTTGCTTTCAATTCTTTAACTGACCTTCCTGGATGTGGCAGCTTTAGCAGCCTTTCTGTATTGATCATTGATCACAAT
:::::::.:::::::::::::::::::::.::::::::::.:: :::: :::::::::::.  :::::::::::::::..: .::::::::::..:.:::
GGAAGCTCTGCAAGAACTCAATGTTGCTTCCAATTCTTTAGCTCACCTGCCTGGATGTGGTTCCTTTAGCAGCCTTTCCATTCTGATCATTGACTATAAT
--E--A--L--Q--E--L--N--V--A--S--N--S--L--A--H--L--P--G--C--G--S--F--S--S--L--S--I--L--I--I--D--Y--N-

----------------------------------------------------------------------------------------------------
-S--V--S--H--P--S--A--D--F--F--Q--S--C--Q--K--M--R--S--I--K--A--G--D--N--P--F--Q--C--T--C--E--L--G--
TCAGTTTCCCACCCATCGGCTGATTTCTTCCAGAGCTGCCAGAAGATGAGGTCAATAAAAGCAGGGGACAATCCATTCCAATGTACCTGTGAGCTAGGAG
:::.::::: :::::::.:::::.::::::::::::::::::::::: :::::  : :::::::::.::::::::::::::::::: :::::::::.:::
TCAATTTCCAACCCATCAGCTGACTTCTTCCAGAGCTGCCAGAAGATTAGGTCCCTCAAAGCAGGGAACAATCCATTCCAATGTACATGTGAGCTAAGAG
-S--I--S--N--P--S--A--D--F--F--Q--S--C--Q--K--I--R--S--L--K--A--G--N--N--P--F--Q--C--T--C--E--L--R--

----------------------------------------------------------------------------------------------------
E--F--V--K--N--I--D--Q--V--S--S--E--V--L--E--G--W--P--D--S--Y--K--C--D--Y--P--E--S--Y--R--G--T--L--L
AATTTGTCAAAAATATAGACCAAGTATCAAGTGAAGTGTTAGAGGGCTGGCCTGATTCTTATAAGTGTGACTACCCGGAAAGTTATAGAGGAACCCTACT
: ::..:: :::.: :::..::::::::.::::: ::: :::::.:.::::::::::::::..::::::: ::.::.:::::.::::..::.::.::.::
ACTTCATCCAAAGTCTAGGTCAAGTATCGAGTGACGTGGTAGAGAGTTGGCCTGATTCTTACGAGTGTGAGTATCCAGAAAGCTATAAGGGGACTCTGCT
D--F--I--Q--S--L--G--Q--V--S--S--D--V--V--E--S--W--P--D--S--Y--E--C--E--Y--P--E--S--Y--K--G--T--L--L

----------------------------------------------------------------------------------------------------
--K--D--F--H--M--S--E--L--S--C--N--I--T--L--L--I--V--T--I--V--A--T--M--L--V--L--A--V--T--V--T--S--L-
AAAGGACTTTCACATGTCTGAATTATCCTGCAACATAACTCTGCTGATCGTCACCATCGTTGCCACCATGCTGGTGTTGGCTGTGACTGTGACCTCCCTC
 ::::::::.:...:.:::::::::::::::::::.:.::::::::::.::::::::::  :.:::.. :::::...::::: : ::..:::::  ::::
CAAGGACTTCCGTGTATCTGAATTATCCTGCAACACAGCTCTGCTGATTGTCACCATCGGAGTCACTGGGCTGGCACTGGCTCTTACCATGACCGGCCTC
--K--D--F--R--V--S--E--L--S--C--N--T--A--L--L--I--V--T--I--G--V--T--G--L--A--L--A--L--T--M--T--G--L-

----------------------------------------------------------------------------------------------------
-C--S--Y--L--D--L--P--W--Y--L--R--M--V--C--Q--W--T--Q--T--R--R--R--A--R--N--I--P--L--E--E--L--Q--R--
TGCAGCTACTTGGATCTGCCCTGGTATCTCAGGATGGTGTGCCAGTGGACCCAGACCCGGCGCAGGGCCAGGAACATACCCTTAGAAGAACTCCAAAGAA
::.. :::::: :::::::::::::::::::::::: ::::.::::::::::::::.:::::::::::.:::::..::::::::::::::::::::::::
TGTGTCTACTTTGATCTGCCCTGGTATCTCAGGATGCTGTGTCAGTGGACCCAGACTCGGCGCAGGGCTAGGAATGTACCCTTAGAAGAACTCCAAAGAA
-C--V--Y--F--D--L--P--W--Y--L--R--M--L--C--Q--W--T--Q--T--R--R--R--A--R--N--V--P--L--E--E--L--Q--R--

----------------------------------------------------------------------------------------------------
N--L--Q--F--H--A--F--I--S--Y--S--G--H--D--S--F--W--V--K--N--E--L--L--P--N--L--E--K--E--G--M--Q--I--C
ATCTCCAGTTTCATGCATTTATTTCATATAGTGGGCACGATTCTTTCTGGGTGAAGAATGAATTATTGCCAAACCTAGAGAAAGAAGGTATGCAGATTTG
 :::::::::.::::: ::.:::::::::::::::::.:::::: ..:::::.::::::::::::.:.:::::. ::::.:::::::::::. :::::::
CTCTCCAGTTCCATGCCTTCATTTCATATAGTGGGCATGATTCTGCTTGGGTAAAGAATGAATTACTACCAAATGTAGAAAAAGAAGGTATAAAGATTTG
T--L--Q--F--H--A--F--I--S--Y--S--G--H--D--S--A--W--V--K--N--E--L--L--P--N--V--E--K--E--G--I--K--I--C

----------------------------------------------------------------------------------------------------
--L--H--E--R--N--F--V--P--G--K--S--I--V--E--N--I--I--T--C--I--E--K--S--Y--K--S--I--F--V--L--S--P--N-
CCTTCATGAGAGAAACTTTGTTCCTGGCAAGAGCATTGTGGAAAATATCATCACCTGCATTGAGAAGAGTTACAAGTCCATCTTTGTTTTGTCTCCCAAC
.::.::::::::::::::::::::::::::::::::..::::::::::::: : ::::::::::::.::.::::::::::::::::::::::::::::::
TCTCCATGAGAGAAACTTTGTTCCTGGCAAGAGCATCATGGAAAATATCATAAACTGCATTGAGAAAAGCTACAAGTCCATCTTTGTTTTGTCTCCCAAC
--L--H--E--R--N--F--V--P--G--K--S--I--M--E--N--I--I--N--C--I--E--K--S--Y--K--S--I--F--V--L--S--P--N-

----------------------------------------------------------------------------------------------------
-F--V--Q--S--E--W--C--H--Y--E--L--Y--F--A--H--H--N--L--F--H--E--G--S--N--S--L--I--L--I--L--L--E--P--
TTTGTCCAGAGTGAATGGTGCCATTATGAACTCTACTTTGCCCATCACAATCTCTTTCATGAAGGATCTAATAGCTTAATCCTGATCTTGCTGGAACCCA
:::::::::::.::.::::::::.::::::::::::::::::::.:::::.:::::.::::::::.:::.:::.::::::::::::::::::::: .:::
TTTGTCCAGAGCGAGTGGTGCCACTATGAACTCTACTTTGCCCACCACAACCTCTTCCATGAAGGGTCTGATAACTTAATCCTGATCTTGCTGGATTCCA
-F--V--Q--S--E--W--C--H--Y--E--L--Y--F--A--H--H--N--L--F--H--E--G--S--D--N--L--I--L--I--L--L--D--S--

----------------------------------------------------------------------------------------------------
I--P--Q--Y--S--I--P--S--S--Y--H--K--L--K--S--L--M--A--R--R--T--Y--L--E--W--P--K--E--K--S--K--R--G--L
TTCCGCAGTACTCCATTCCTAGCAGTTATCACAAGCTCAAAAGTCTCATGGCCAGGAGGACTTATTTGGAATGGCCCAAGGAAAAGAGCAAACGTGGCCT
::::.:::::.:::::.::.:::::.::::::::.::::::. :::::::::  .: :.:::::::::::::::::::::::.::::::::::.::: ::
TTCCACAGTATTCCATCCCCAGCAGCTATCACAAACTCAAAGCTCTCATGGCACAGCGAACTTATTTGGAATGGCCCAAGGAGAAGAGCAAACATGGACT
I--P--Q--Y--S--I--P--S--S--Y--H--K--L--K--A--L--M--A--Q--R--T--Y--L--E--W--P--K--E--K--S--K--H--G--L

------------------------------------------------------------>
--F--W--A--N--L--R--A--A--I--N--I--K--L--T--E--Q--A--K--K--*-
TTTTTGGGCTAACTTAAGGGCAGCCATTAATATTAAGCTGACAGAGCAAGCAAAGAAATAG
::::::::::::..:.::.::: :::::::::::::..:::..::: :::::.:..::   
TTTTTGGGCTAATCTGAGAGCATCCATTAATATTAAATTGATGGAGAAAGCAGAAGAA---
--F--W--A--N--L--R--A--S--I--N--I--K--L--M--E--K--A--E--E----

Pig Consensus Sequence

>BGISUST0000890933
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
---------------TTGGACGTGTCAGTCAGCACCGCAGTAAATCTGGAACTGTCCAATATCAGATGTGTGCTGGATGCTAACGGATGTCATCACTTCC
AAAATGTTCTATTGAAACTTCAAAAGAACTCAAAGTTATCCAACCTGACTTTGAACAACATTGAAACCACTTGGAATTCTTTCATTACCACCCTCCAGTT
TGTCTGGCATACAAGCATCGAGTATTTTTCCATTTCCAGTGTAAAACTACAAGGTCAGCTGGACTTCAGAGATTTTGATTATTCTGACACGTCACTGAAG
GCCTTGTCTCTACACCAAGTTGTCAGTGAGGTGTTCAGTTTCCCACAAAGTTATATCTATAAAATCTTTTCAAATATGAACATTCAGTATCTCACAGTGT
CTGCCACACACATGGTCCACATGGTTTGCCCATCCCAAATTAGCCCATTTCTATATTTGGATTTTTCCAATAATGCCTTAACAGACATGGTTTTTAAAAA
TTGTGCAAACTTGGCTAATTTGAACACACTCAGTTTACAAATGAATCAGTTAAAAGAACTTGTGAATGTCATCCATATGACCAAAGAAATGCAGTCTCTA
CAGCAATTGGATGTTAGCCAGAATACCCTGAGGTATGATGAAAATGAGGGAAGTTGCACTTGGACTGGAAGTTTATTAAGTTTAAATTTATCTTCAAATA
TACTCACTGACTCTGTTTTCAGATGTTTACCTCCCAGGGTCAAGGTTCTTGATCTTCACAATAACAGAATAAGGAGCATCCCTAAGGATGTCGCCCATCT
GGAAGCTCTGCAAGAACTCAATGTTGCTTCCAATTCTTTAGCTCACCTGCCTGGATGTGGTTCCTTTAGCAGCCTTTCCATTCTGATCATTGACTATAAT
TCAATTTCCAACCCATCAGCTGACTTCTTCCAGAGCTGCCAGAAGATTAGGTCCCTCAAAGCAGGGAACAATCCATTCCAATGTACATGTGAGCTAAGAG
ACTTCATCCAAAGTCTAGGTCAAGTATCGAGTGACGTGGTAGAGAGTTGGCCTGATTCTTACGAGTGTGAGTATCCAGAAAGCTATAAGGGGACTCTGCT
CAAGGACTTCCGTGTATCTGAATTATCCTGCAACACAGCTCTGCTGATTGTCACCATCGGAGTCACTGGGCTGGCACTGGCTCTTACCATGACCGGCCTC
TGTGTCTACTTTGATCTGCCCTGGTATCTCAGGATGCTGTGTCAGTGGACCCAGACTCGGCGCAGGGCTAGGAATGTACCCTTAGAAGAACTCCAAAGAA
CTCTCCAGTTCCATGCCTTCATTTCATATAGTGGGCATGATTCTGCTTGGGTAAAGAATGAATTACTACCAAATGTAGAAAAAGAAGGTATAAAGATTTG
TCTCCATGAGAGAAACTTTGTTCCTGGCAAGAGCATCATGGAAAATATCATAAACTGCATTGAGAAAAGCTACAAGTCCATCTTTGTTTTGTCTCCCAAC
TTTGTCCAGAGCGAGTGGTGCCACTATGAACTCTACTTTGCCCACCACAACCTCTTCCATGAAGGGTCTGATAACTTAATCCTGATCTTGCTGGATTCCA
TTCCACAGTATTCCATCCCCAGCAGCTATCACAAACTCAAAGCTCTCATGGCACAGCGAACTTATTTGGAATGGCCCAAGGAGAAGAGCAAACATGGACT
TTTTTGGGCTAATCTGAGAGCATCCATTAATATTAAATTGATGGAGAAAGCAGAAGAA


>BGISUSP0000890933
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-----LDVSVSTAVNLELSNIRCVLDANGCHHFQNVLLKLQKNSKLSNLTLNNIETTWNSFITTLQFVWHTSIEYFSISSVKLQGQLDFRDFDYSDTSLK
ALSLHQVVSEVFSFPQSYIYKIFSNMNIQYLTVSATHMVHMVCPSQISPFLYLDFSNNALTDMVFKNCANLANLNTLSLQMNQLKELVNVIHMTKEMQSL
QQLDVSQNTLRYDENEGSCTWTGSLLSLNLSSNILTDSVFRCLPPRVKVLDLHNNRIRSIPKDVAHLEALQELNVASNSLAHLPGCGSFSSLSILIIDYN
SISNPSADFFQSCQKIRSLKAGNNPFQCTCELRDFIQSLGQVSSDVVESWPDSYECEYPESYKGTLLKDFRVSELSCNTALLIVTIGVTGLALALTMTGL
CVYFDLPWYLRMLCQWTQTRRRARNVPLEELQRTLQFHAFISYSGHDSAWVKNELLPNVEKEGIKICLHERNFVPGKSIMENIINCIEKSYKSIFVLSPN
FVQSEWCHYELYFAHHNLFHEGSDNLILILLDSIPQYSIPSSYHKLKALMAQRTYLEWPKEKSKHGLFWANLRASINIKLMEKAEE