Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000174130 (click for geneview)
Transcript ID ENST00000308993(link to ensembl)
Symbol TLR6
Localtion Chromosome:4:38651270:38653660:-1 band: 4p14
Description Toll-like receptor 6 precursor. [Source:Uniprot/SWISSPROT;Acc:Q9Y2C9]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--T--K--D--K--E--P--I--V--K--S--F--H--F--V--C--L--M--I--I--I--V--G--T--R--I--Q--F--S--D--G--N--E--
ATGACCAAAGACAAAGAACCTATTGTTAAAAGCTTCCATTTTGTTTGCCTTATGATCATAATAGTTGGAACCAGAATCCAGTTCTCCGACGGAAATGAAT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
F--A--V--D--K--S--K--R--G--L--I--H--V--P--K--D--L--P--L--K--T--K--V--L--D--M--S--Q--N--Y--I--A--E--L
TTGCAGTAGACAAGTCAAAAAGAGGTCTTATTCATGTTCCAAAAGACCTACCGCTGAAAACCAAAGTCTTAGATATGTCTCAGAACTACATCGCTGAGCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--Q--V--S--D--M--S--F--L--S--E--L--T--V--L--R--L--S--H--N--R--I--Q--L--L--D--L--S--V--F--K--F--N--Q-
TCAGGTCTCTGACATGAGCTTTCTATCAGAGTTGACAGTTTTGAGACTTTCCCATAACAGAATCCAGCTACTTGATTTAAGTGTTTTCAAGTTCAACCAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-D--L--E--Y--L--D--L--S--H--N--Q--L--Q--K--I--S--C--H--P--I--V--S--F--R--H--L--D--L--S--F--N--D--F--
GATTTAGAATATTTGGATTTATCTCATAATCAGTTGCAAAAGATATCCTGCCATCCTATTGTGAGTTTCAGGCATTTAGATCTCTCATTCAATGATTTCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
K--A--L--P--I--C--K--E--F--G--N--L--S--Q--L--N--F--L--G--L--S--A--M--K--L--Q--K--L--D--L--L--P--I--A
AGGCCCTGCCCATCTGTAAGGAATTTGGCAACTTATCACAACTGAATTTCTTGGGATTGAGTGCTATGAAGCTGCAAAAATTAGATTTGCTGCCAATTGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--H--L--H--L--S--Y--I--L--L--D--L--R--N--Y--Y--I--K--E--N--E--T--E--S--L--Q--I--L--N--A--K--T--L--H-
TCACTTGCATCTAAGTTATATCCTTCTGGATTTAAGAAATTATTATATAAAAGAAAATGAGACAGAAAGTCTACAAATTCTGAATGCAAAAACCCTTCAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-L--V--F--H--P--T--S--L--F--A--I--Q--V--N--I--S--V--N--T--L--G--C--L--Q--L--T--N--I--K--L--N--D--D--
CTTGTTTTTCACCCAACTAGTTTATTCGCTATCCAAGTGAACATATCAGTTAATACTTTAGGGTGCTTACAACTGACTAATATTAAATTGAATGATGACA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
N--C--Q--V--F--I--K--F--L--S--E--L--T--R--G--S--T--L--L--N--F--T--L--N--H--I--E--T--T--W--K--C--L--V
ACTGTCAAGTTTTCATTAAATTTTTATCAGAACTCACCAGAGGTTCAACCTTACTGAATTTTACCCTCAACCACATAGAAACGACTTGGAAATGCCTGGT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--R--V--F--Q--F--L--W--P--K--P--V--E--Y--L--N--I--Y--N--L--T--I--I--E--S--I--R--E--E--D--F--T--Y--S-
CAGAGTCTTTCAATTTCTTTGGCCCAAACCTGTGGAATATCTCAATATTTACAATTTAACAATAATTGAAAGCATTCGTGAAGAAGATTTTACTTATTCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-K--T--T--L--K--A--L--T--I--E--H--I--T--N--Q--V--F--L--F--S--Q--T--A--L--Y--T--V--F--S--E--M--N--I--
AAAACGACATTGAAAGCATTGACAATAGAACATATCACGAACCAAGTTTTTCTGTTTTCACAGACAGCTTTGTACACCGTGTTTTCTGAGATGAACATTA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
M--M--L--T--I--S--D--T--P--F--I--H--M--L--C--P--H--A--P--S--T--F--K--F--L--N--F--T--Q--N--V--F--T--D
TGATGTTAACCATTTCAGATACACCTTTTATACACATGCTGTGTCCTCATGCACCAAGCACATTCAAGTTTTTGAACTTTACCCAGAACGTTTTCACAGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--S--I--F--E--K--C--S--T--L--V--K--L--E--T--L--I--L--Q--K--N--G--L--K--D--L--F--K--V--G--L--M--T--K-
TAGTATTTTTGAAAAATGTTCCACGTTAGTTAAATTGGAGACACTTATCTTACAAAAGAATGGATTAAAAGACCTTTTCAAAGTAGGTCTCATGACGAAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-D--M--P--S--L--E--I--L--D--V--S--W--N--S--L--E--S--G--R--H--K--E--N--C--T--W--V--E--S--I--V--V--L--
GATATGCCTTCTTTGGAAATACTGGATGTTAGCTGGAATTCTTTGGAATCTGGTAGACATAAAGAAAACTGCACTTGGGTTGAGAGTATAGTGGTGTTAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
N--L--S--S--N--M--L--T--D--S--V--F--R--C--L--P--P--R--I--K--V--L--D--L--H--S--N--K--I--K--S--V--P--K
ATTTGTCTTCAAATATGCTTACTGACTCTGTTTTCAGATGTTTACCTCCCAGGATCAAGGTACTTGATCTTCACAGCAATAAAATAAAGAGCGTTCCTAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--Q--V--V--K--L--E--A--L--Q--E--L--N--V--A--F--N--S--L--T--D--L--P--G--C--G--S--F--S--S--L--S--V--L-
ACAAGTCGTAAAACTGGAAGCTTTGCAAGAACTCAATGTTGCTTTCAATTCTTTAACTGACCTTCCTGGATGTGGCAGCTTTAGCAGCCTTTCTGTATTG
                                     :::::::.::::::::::.:: :::: :::::.:::::.  :::::::::::::::..: .::
-------------------------------------GTTGCTTCCAATTCTTTAGCTCACCTGCCTGGGTGTGGTTCCTTTAGCAGCCTTTCCATTCTG
--------------------------------------V--A--S--N--S--L--A--H--L--P--G--C--G--S--F--S--S--L--S--I--L-

----------------------------------------------------------------------------------------------------
-I--I--D--H--N--S--V--S--H--P--S--A--D--F--F--Q--S--C--Q--K--M--R--S--I--K--A--G-----D--N--P--F--Q--
ATCATTGATCACAATTCAGTTTCCCACCCATCGGCTGATTTCTTCCAGAGCTGCCAGAAGATGAGGTCAATAAAAGCAGGG---GACAATCCATTCCAAT
::::::::..:.::::::.::::: :::::::.:::::.::::::::::::::::::::::: :::::  : :::::::::   .:::::::::::::::
ATCATTGACTATAATTCAATTTCCAACCCATCAGCTGACTTCTTCCAGAGCTGCCAGAAGATTAGGTCCCTCAAAGCAGGGG--AACAATCCATTCCAAT
-I--I--D--Y--N--S--I--S--N--P--S--A--D--F--F--Q--S--C--Q--K--I--R--S--L--K--A--G--\--D--N--P--F--Q--

----------------------------------------------------------------------------------------------------
C--T--C--E--L--R--E--F--V--K--N--I--D--Q--V--S--S--E--V--L--E--G--W--P--D--S--Y--K--C--D--Y--P--E--S
GTACCTGTGAGCTAAGAGAATTTGTCAAAAATATAGACCAAGTATCAAGTGAAGTGTTAGAGGGCTGGCCTGATTCTTATAAGTGTGACTACCCAGAAAG
:::: :::::::::::::: ::..:: :::.: :::..::::::::.::::: ::: :::::.:.::::::::::::::..::::::: ::.::::::::
GTACATGTGAGCTAAGAGACTTCATCCAAAGTCTAGGTCAAGTATCGAGTGACGTGGTAGAGAGTTGGCCTGATTCTTACGAGTGTGAGTATCCAGAAAG
C--T--C--E--L--R--D--F--I--Q--S--L--G--Q--V--S--S--D--V--V--E--S--W--P--D--S--Y--E--C--E--Y--P--E--S

----------------------------------------------------------------------------------------------------
--Y--R--G--S--P--L--K--D--F--H--M--S--E--L--S--C--N--I--T--L--L--I--V--T--I--G--A--T--M--L--V--L--A-
TTATAGAGGAAGCCCACTAAAGGACTTTCACATGTCTGAATTATCCTGCAACATAACTCTGCTGATCGTCACCATCGGTGCCACCATGCTGGTGTTGGCT
:::::..::.: .:..:: ::::::::.:...:.:::::::::::::::::::.:.::::::::::.::::::::::: :.:::.. :::::..::::::
TTATAAGGGGACTCTGCTCAAGGACTTCCGTGTATCTGAATTATCCTGCAACACAGCTCTGCTGATTGTCACCATCGGAGTCACTGGGCTGGCATTGGCT
--Y--K--G--T--L--L--K--D--F--R--V--S--E--L--S--C--N--T--A--L--L--I--V--T--I--G--V--T--G--L--A--L--A-

----------------------------------------------------------------------------------------------------
-V--T--V--T--S--L--C--I--Y--L--D--L--P--W--Y--L--R--M--V--C--Q--W--T--Q--T--R--R--R--A--R--N--I--P--
GTGACTGTGACCTCCCTCTGCATCTACTTGGATCTGCCCTGGTATCTCAGGATGGTGTGCCAGTGGACCCAGACTCGGCGCAGGGCCAGGAACATACCCT
 : ::..:::::  ::::::..::::::: :::::::::::::::::::::::: ::::.::::::::::::::::::::::::::.:::::..::::::
CTTACCATGACCGGCCTCTGTGTCTACTTTGATCTGCCCTGGTATCTCAGGATGCTGTGTCAGTGGACCCAGACTCGGCGCAGGGCTAGGAATGTACCCT
-L--T--M--T--G--L--C--V--Y--F--D--L--P--W--Y--L--R--M--L--C--Q--W--T--Q--T--R--R--R--A--R--N--V--P--

----------------------------------------------------------------------------------------------------
L--E--E--L--Q--R--N--L--Q--F--H--A--F--I--S--Y--S--E--H--D--S--A--W--V--K--S--E--L--V--P--Y--L--E--K
TAGAAGAACTCCAAAGAAACCTCCAGTTTCATGCTTTTATTTCATATAGTGAACATGATTCTGCCTGGGTGAAAAGTGAATTGGTACCTTACCTAGAAAA
:::::::::::::::::: .::::::::.:::::.::.:::::::::::::::::.::::::::::::::.::::.::::.:::::::::..:::::: :
TAGAAGAACTCCAAAGAACTCTCCAGTTCCATGCCTTCATTTCATATAGTGAACACGATTCTGCCTGGGTAAAAAATGAACTGGTACCTTGTCTAGAANA
L--E--E--L--Q--R--T--L--Q--F--H--A--F--I--S--Y--S--E--H--D--S--A--W--V--K--N--E--L--V--P--C--L--E--X

----------------------------------------------------------------------------------------------------
--E--D--I--Q--I--C--L--H--E--R--N--F--V--P--G--K--S--I--V--E--N--I--I--N--C--I--E--K--S--Y--K--S--I-
AGAAGATATACAGATTTGTCTTCATGAGAGAAACTTTGTCCCTGGCAAGAGCATTGTGGAAAATATCATCAACTGCATTGAGAAGAGTTACAAGTCCATC
:::::.:::: ::::::::::.:::::::::::::::::.::::::::::::::..::::::::::::: ::::::::::::::.::.::::::::::::
AGAAGGTATAAAGATTTGTCTCCATGAGAGAAACTTTGTTCCTGGCAAGAGCATCATGGAAAATATCATAAACTGCATTGAGAAAAGCTACAAGTCCATC
--E--G--I--K--I--C--L--H--E--R--N--F--V--P--G--K--S--I--M--E--N--I--I--N--C--I--E--K--S--Y--K--S--I-

----------------------------------------------------------------------------------------------------
-F--V--L--S--P--N--F--V--Q--S--E--W--C--H--Y--E--L--Y--F--A--H--H--N--L--F--H--E--G--S--N--N--L--I--
TTTGTTTTGTCTCCCAACTTTGTCCAGAGTGAGTGGTGCCATTACGAACTCTATTTTGCCCATCACAATCTCTTTCATGAAGGATCTAATAACTTAATCC
:::::::::::::::::::::::::::::.:::                                                                   
TTTGTTTTGTCTCCCAACTTTGTCCAGAGCGAG-------------------------------------------------------------------
-F--V--L--S--P--N--F--V--Q--S--E--------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
L--I--L--L--E--P--I--P--Q--N--S--I--P--N--K--Y--H--K--L--K--A--L--M--T--Q--R--T--Y--L--Q--W--P--K--E
TCATCTTACTGGAACCCATTCCACAGAACAGCATTCCCAACAAGTACCACAAGCTGAAGGCTCTCATGACGCAGCGGACTTATTTGCAGTGGCCCAAGGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------------------------------------------------------------------------------->
--K--S--K--R--G--L--F--W--A--N--I--R--A--A--F--N--M--K--L--T--L--V--T--E--N--N--D--V--K--S--*-
GAAAAGCAAACGTGGGCTCTTTTGGGCTAACATTAGAGCCGCTTTTAATATGAAATTAACACTAGTCACTGAAAACAATGATGTGAAATCTTAA
                                                                                              
----------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------

Pig Consensus Sequence

>BGISUST0000889787
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-------------------------------------GTTGCTTCCAATTCTTTAGCTCACCTGCCTGGGTGTGGTTCCTTTAGCAGCCTTTCCATTCTG
ATCATTGACTATAATTCAATTTCCAACCCATCAGCTGACTTCTTCCAGAGCTGCCAGAAGATTAGGTCCCTCAAAGCAGGgaACAATCCATTCCAATGTA
CATGTGAGCTAAGAGACTTCATCCAAAGTCTAGGTCAAGTATCGAGTGACGTGGTAGAGAGTTGGCCTGATTCTTACGAGTGTGAGTATCCAGAAAGTTA
TAAGGGGACTCTGCTCAAGGACTTCCGTGTATCTGAATTATCCTGCAACACAGCTCTGCTGATTGTCACCATCGGAGTCACTGGGCTGGCATTGGCTCTT
ACCATGACCGGCCTCTGTGTCTACTTTGATCTGCCCTGGTATCTCAGGATGCTGTGTCAGTGGACCCAGACTCGGCGCAGGGCTAGGAATGTACCCTTAG
AAGAACTCCAAAGAACTCTCCAGTTCCATGCCTTCATTTCATATAGTGAACACGATTCTGCCTGGGTAAAAAATGAACTGGTACCTTGTCTAGAANAAGA
AGGTATAAAGATTTGTCTCCATGAGAGAAACTTTGTTCCTGGCAAGAGCATCATGGAAAATATCATAAACTGCATTGAGAAAAGCTACAAGTCCATCTTT
GTTTTGTCTCCCAACTTTGTCCAGAGCGAG----------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-------------------------------------------------------------------------------------------


>BGISUSP0000889787
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-------------------------------------------------------------------------------VASNSLAHLPGCGSFSSLSIL
IIDYNSISNPSADFFQSCQKIRSLKAGNNPFQCTCELRDFIQSLGQVSSDVVESWPDSYECEYPESYKGTLLKDFRVSELSCNTALLIVTIGVTGLALAL
TMTGLCVYFDLPWYLRMLCQWTQTRRRARNVPLEELQRTLQFHAFISYSEHDSAWVKNELVPCLE-EGIKICLHERNFVPGKSIMENIINCIEKSYKSIF
VLSPNFVQSE---------------------------------------------------------------------------------------