Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000174145 (click for geneview)
Transcript ID ENST00000309447(link to ensembl)
Symbol Q9ULI1_HUMAN
Localtion Chromosome:4:37267909:37273650:1 band: 4p14
Description PREDICTED: KIAA1239 protein
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-Q--V--L--K--H--Q--L--L--R--V--K--R--K--V--T--S--G--Q--Q--I--Y--V--N--N--A--L--S--K--C--T--L--P--M--
CAGGTCCTCAAACACCAGCTGCTGCGCGTCAAAAGGAAGGTCACATCAGGCCAGCAGATTTATGTGAACAATGCATTATCCAAGTGCACACTGCCAATGT
::::::::::::::::::::::::::.:::::.::::::::::::::.::::::::::: ::.:: :::::.:: :: :::::::::::.::::: ::::
CAGGTCCTCAAACACCAGCTGCTGCGTGTCAAGAGGAAGGTCACATCGGGCCAGCAGATGTACGTCAACAACGCCTTCTCCAAGTGCACGCTGCCCATGT
-Q--V--L--K--H--Q--L--L--R--V--K--R--K--V--T--S--G--Q--Q--M--Y--V--N--N--A--F--S--K--C--T--L--P--M--

----------------------------------------------------------------------------------------------------
F--V--N--L--T--F--R--E--V--R--H--W--R--S--H--K--D--V--D--E--S--S--L--S--V--T--V--H--E--S--I--E--Q--L
TTGTGAACCTGACCTTCAGGGAGGTGAGGCACTGGAGATCTCACAAAGACGTCGATGAATCCTCCCTCTCTGTCACCGTTCATGAAAGTATAGAGCAGTT
::::::::::::::::: :::::::::..:::::: :::: ::::..::::: ::.::.:::::::::: ::::::::::::.::.::.:::::::::.:
TTGTGAACCTGACCTTCCGGGAGGTGAAACACTGGCGATCACACAGGGACGTGGACGAGTCCTCCCTCTGTGTCACCGTTCACGAGAGCATAGAGCAGCT
F--V--N--L--T--F--R--E--V--K--H--W--R--S--H--R--D--V--D--E--S--S--L--C--V--T--V--H--E--S--I--E--Q--L

----------------------------------------------------------------------------------------------------
--F--W--S--L--E--K--K--C--G--Q--K--L--V--S--R--A--L--G--Y--I--T--M--A--K--M--G--L--S--E--M--E--L--E-
ATTCTGGTCCTTGGAGAAGAAGTGTGGTCAGAAACTGGTCTCTAGGGCTCTTGGTTACATCACCATGGCCAAAATGGGTCTGAGTGAAATGGAACTGGAG
 :::::::::.:::::::::.:::::: :::: ::: :::::. :::::::::::::::::::::::::::::::::::::::::::::::::.::::::
CTTCTGGTCCCTGGAGAAGAGGTGTGGGCAGATACTTGTCTCCCGGGCTCTTGGTTACATCACCATGGCCAAAATGGGTCTGAGTGAAATGGAGCTGGAG
--F--W--S--L--E--K--R--C--G--Q--I--L--V--S--R--A--L--G--Y--I--T--M--A--K--M--G--L--S--E--M--E--L--E-

----------------------------------------------------------------------------------------------------
-D--V--L--A--L--D--N--S--V--M--S--E--L--K--E--N--T--R--P--S--N--P--L--R--V--P--Y--L--Y--I--A--R--L--
GATGTGTTAGCCCTAGACAACAGTGTAATGAGTGAGCTCAAAGAAAACACCAGACCCAGCAATCCCCTGAGAGTACCTTACTTGTACATTGCAAGGCTCA
::.:::.:.::::: ::::::::.:: :::::.:::::: : ::...:.::::.::..:::::::::::::.::::::::..::::.::.::.:::::::
GACGTGCTGGCCCTTGACAACAGCGTTATGAGCGAGCTCCACGAGGGCGCCAGGCCTGGCAATCCCCTGAGGGTACCTTATCTGTATATCGCGAGGCTCA
-D--V--L--A--L--D--N--S--V--M--S--E--L--H--E--G--A--R--P--G--N--P--L--R--V--P--Y--L--Y--I--A--R--L--

----------------------------------------------------------------------------------------------------
K--E--G--L--S--G--Y--L--I--E--R--H--V--K--N--V--T--L--L--V--W--A--N--R--H--L--Q--L--I--A--Q--K--L--Y
AGGAGGGTCTCAGTGGATACCTAATAGAAAGACATGTGAAAAATGTCACACTCCTAGTCTGGGCCAACAGACACCTGCAGCTCATAGCCCAGAAGCTATA
::::::: ::::::::.:::::::: ::.:::::.::::::::.::::: :::::.::::::::::::::::::::::::::::: :::::::::::.::
AGGAGGGGCTCAGTGGGTACCTAATTGAGAGACACGTGAAAAACGTCACCCTCCTGGTCTGGGCCAACAGACACCTGCAGCTCATCGCCCAGAAGCTGTA
K--E--G--L--S--G--Y--L--I--E--R--H--V--K--N--V--T--L--L--V--W--A--N--R--H--L--Q--L--I--A--Q--K--L--Y

----------------------------------------------------------------------------------------------------
--L--Q--D--D--N--D--L--R--E--M--H--T--I--L--A--D--Y--F--L--G--V--W--S--G--G--R--R--K--A--F--C--L--E-
TCTGCAGGATGACAATGACCTGCGTGAAATGCACACCATCTTAGCAGATTATTTTCTGGGGGTTTGGTCAGGGGGCAGGAGGAAAGCCTTCTGCCTTGAG
:::::::::.::: . ::::::::::::::::::::::::.:.:: ::.::.::.::::::::.:::::::::::: ::::::::::.::::::::.::.
TCTGCAGGACGACCGGGACCTGCGTGAAATGCACACCATCCTGGCTGACTACTTCCTGGGGGTCTGGTCAGGGGGCCGGAGGAAAGCTTTCTGCCTCGAA
--L--Q--D--D--R--D--L--R--E--M--H--T--I--L--A--D--Y--F--L--G--V--W--S--G--G--R--R--K--A--F--C--L--E-

----------------------------------------------------------------------------------------------------
-D--P--Y--L--N--G--C--L--D--L--E--N--R--S--L--L--E--E--E--K--H--F--M--E--Q--A--S--F--D--R--Q--A--P--
GACCCCTACTTGAATGGCTGCCTTGACTTGGAGAACAGAAGTTTGCTGGAGGAAGAAAAGCACTTCATGGAACAGGCTTCCTTTGACAGGCAGGCTCCAG
:::.:::::.::::::::::::::::::::::::.::: ::..:::: :: :::::::::::.::::::::.:::::::::::.:::::::::::.::::
GACTCCTACCTGAATGGCTGCCTTGACTTGGAGAGCAGCAGCCTGCTTGATGAAGAAAAGCATTTCATGGAGCAGGCTTCCTTCGACAGGCAGGCCCCAG
-D--S--Y--L--N--G--C--L--D--L--E--S--S--S--L--L--D--E--E--K--H--F--M--E--Q--A--S--F--D--R--Q--A--P--

----------------------------------------------------------------------------------------------------
D--Q--P--W--V--F--Q--C--N--P--L--E--P--D--I--F--F--V--N--H--R--K--M--S--E--L--L--Y--H--L--T--R--C--G
ACCAGCCCTGGGTTTTCCAGTGTAATCCCCTGGAACCTGACATCTTTTTCGTTAATCATCGGAAAATGTCTGAGCTGTTGTACCACTTGACGAGGTGTGG
:::::::::::::::::::::::::.:: :::::.:::::::::::.::.::.:::::.:::::::::: :::::: .::                    
ACCAGCCCTGGGTTTTCCAGTGTAACCCACTGGAGCCTGACATCTTCTTTGTCAATCACCGGAAAATGTGTGAGCTCCTG--------------------
D--Q--P--W--V--F--Q--C--N--P--L--E--P--D--I--F--F--V--N--H--R--K--M--C--E--L--L---------------------

----------------------------------------------------------------------------------------------------
--K--T--D--D--L--L--Y--G--I--I--M--N--F--S--W--L--Y--T--M--I--K--I--G--Q--F--D--K--V--L--S--D--I--E-
AAAAACCGATGACCTGCTTTACGGCATCATCATGAACTTCAGCTGGCTTTATACCATGATCAAAATTGGCCAGTTTGACAAAGTGCTTTCAGACATTGAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-L--A--Y--N--Y--S--Q--E--K--E--L--K--F--L--A--N--T--L--R--S--I--K--N--K--V--T--A--F--P--G--S--L--S--
CTGGCTTACAACTACTCGCAAGAGAAGGAGCTGAAGTTCCTGGCCAACACCCTCCGCAGCATCAAAAACAAGGTCACTGCATTTCCCGGCTCCCTTTCAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
A--E--L--Q--Q--R--L--L--P--V--V--S--S--L--P--K--L--R--H--L--L--L--E--C--D--K--D--G--P--K--Y--C--S--I
CAGAGCTTCAGCAAAGACTGCTGCCTGTTGTAAGCTCCCTGCCCAAACTTAGACATCTTCTTTTAGAGTGTGATAAAGATGGGCCCAAATATTGCTCCAT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--V--P--L--H--S--S--M--D--V--T--Y--S--P--E--R--L--P--L--S--S--S--H--L--H--V--T--E--I--L--P--T--C--N-
TGTACCACTGCATTCATCCATGGATGTGACATACAGCCCAGAGCGTCTTCCCTTATCATCCAGTCACCTGCATGTCACAGAGATCCTGCCTACCTGTAAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-P--S--T--V--L--T--A--L--E--N--G--S--I--S--T--W--D--V--E--T--R--Q--L--L--R--Q--I--T--T--A--Q--S--V--
CCCAGCACTGTCCTCACAGCTTTAGAAAATGGTTCCATCAGCACCTGGGATGTAGAGACTCGACAGCTACTCAGGCAAATCACCACAGCCCAGTCTGTCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
I--L--G--M--K--L--T--S--D--E--K--Y--L--V--V--A--T--T--N--N--T--L--L--I--Y--D--N--V--N--S--C--L--L--S
TCCTGGGCATGAAACTCACCAGTGATGAAAAGTACCTTGTGGTGGCTACAACAAATAACACCTTGTTGATTTATGACAATGTCAATTCTTGCCTCCTGTC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--E--V--E--I--K--G--T--K--H--G--S--S--A--T--Y--I--N--G--F--T--L--S--A--N--H--A--L--A--W--L--E--A--S-
TGAAGTAGAAATCAAGGGGACCAAGCATGGAAGCAGCGCCACCTACATCAATGGATTTACACTGTCCGCCAACCACGCCCTTGCATGGCTCGAAGCCAGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-K--D--V--T--V--I--D--L--L--Y--G--W--P--L--Y--Q--F--H--C--W--Y--E--V--T--C--V--Q--C--S--L--D--G--L--
AAAGATGTCACTGTCATCGATCTGCTGTACGGATGGCCGCTTTACCAGTTCCACTGCTGGTATGAAGTGACGTGCGTCCAGTGCTCCCTGGATGGTCTGT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
Y--A--F--C--G--Q--Y--L--N--T--T--T--I--F--H--L--G--S--G--E--K--L--C--T--V--T--S--E--F--S--G--G--F--V
ATGCTTTCTGTGGCCAATACCTGAACACAACCACCATATTTCATTTAGGGAGTGGAGAAAAGTTATGTACAGTGACATCAGAATTTTCAGGTGGATTTGT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--K--F--L--L--I--L--D--T--A--Q--E--M--V--M--V--D--S--E--G--S--L--S--V--W--N--T--E--D--I--S--S--P--Q-
GAAGTTTCTTCTTATCTTGGACACAGCTCAGGAAATGGTCATGGTAGACAGTGAAGGAAGTCTTTCTGTTTGGAATACTGAGGACATTTCCAGCCCCCAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-L--T--D--D--F--D--C--R--R--E--D--S--E--V--V--S--I--E--L--S--E--D--Q--S--A--V--L--I--C--K--A--L--S--
CTGACTGATGACTTTGATTGCCGAAGAGAAGACAGTGAGGTGGTCAGCATTGAGCTTTCAGAAGACCAAAGTGCAGTTCTGATCTGTAAAGCCCTCAGCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
I--E--L--L--D--T--G--L--W--K--V--A--E--K--F--R--A--K--H--N--E--R--F--I--S--A--V--L--S--K--N--G--D--C
TTGAGCTCTTAGATACTGGTCTGTGGAAGGTGGCTGAAAAGTTCAGAGCCAAGCACAACGAACGCTTTATATCTGCCGTGCTGTCTAAAAATGGAGATTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--I--I--A--T--M--E--N--T--S--A--V--F--F--W--R--R--D--T--G--Q--C--M--A--S--L--Q--E--I--S--G--S--I--V-
TATCATCGCCACCATGGAAAATACCTCAGCTGTGTTTTTTTGGAGGCGGGACACAGGACAGTGTATGGCAAGCTTGCAGGAAATCTCAGGTTCCATTGTT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-K--L--V--K--S--S--H--H--N--M--L--L--S--L--S--T--S--G--V--L--S--I--W--D--I--D--I--I--T--A--M--S--N--
AAGTTAGTGAAATCCAGTCACCACAATATGCTACTGTCTTTATCAACCAGTGGTGTTCTTTCCATTTGGGACATAGATATAATCACAGCTATGTCCAACA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
I--D--K--T--G--K--P--I--Q--S--L--L--L--P--A--R--G--E--I--I--Y--S--L--D--G--S--D--C--V--H--K--W--N--F
TAGATAAGACTGGAAAACCCATCCAAAGTCTGTTGTTGCCTGCTAGAGGGGAAATCATTTACTCCCTGGATGGATCCGATTGTGTTCATAAGTGGAACTT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--S--S--G--F--I--E--A--V--F--K--H--E--G--I--V--E--H--C--V--L--T--S--T--G--D--I--M--V--T--S--D--D--K-
CAGCAGTGGCTTCATCGAAGCAGTATTCAAGCATGAAGGAATAGTTGAACACTGTGTGTTAACATCCACCGGAGATATAATGGTGACATCAGATGACAAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-S--S--Q--Y--V--W--H--T--S--S--G--E--N--L--F--R--I--N--G--Q--R--I--S--Q--L--L--I--T--H--N--D--Q--F--
AGCAGCCAGTATGTCTGGCACACCAGCAGTGGTGAAAACCTTTTTCGAATTAACGGGCAGAGAATATCTCAGCTGCTGATTACACACAATGACCAGTTTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
V--V--S--L--C--E--E--N--A--S--R--V--W--R--L--A--T--G--H--R--V--C--N--I--L--T--T--L--Q--N--A--F--I--T
TGGTCTCGCTCTGTGAGGAAAATGCCTCCAGGGTTTGGAGGCTCGCCACAGGCCACAGGGTCTGCAACATTCTGACCACTTTGCAGAATGCCTTTATTAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--S--A--N--T--F--V--V--G--M--T--K--S--K--V--L--A--V--S--L--W--T--G--S--I--T--K--K--F--C--C--E--D--G-
CTCCGCAAATACCTTCGTGGTGGGAATGACTAAAAGCAAAGTGTTGGCAGTCAGTCTTTGGACAGGAAGTATCACCAAGAAATTTTGCTGTGAAGATGGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-T--T--I--V--N--F--K--L--I--P--D--C--P--D--I--I--V--F--I--T--S--A--E--T--V--N--I--W--S--L--T--D--E--
ACCACCATCGTGAATTTTAAATTAATCCCTGACTGTCCTGATATCATCGTGTTTATCACATCGGCCGAGACTGTGAACATCTGGAGTCTGACAGATGAAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
V--I--C--R--R--V--Q--L--P--N--N--F--L--K--N--L--E--D--F--E--I--S--P--N--G--K--L--G--I--I--A--R--G--D
TGATCTGTCGGCGCGTGCAACTTCCAAACAACTTCTTGAAAAATCTGGAGGACTTTGAAATTTCTCCCAATGGAAAGCTAGGCATTATAGCCAGGGGAGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--E--N--I--N--V--L--D--L--Y--S--G--K--L--R--V--V--H--A--S--G--I--I--W--R--Q--R--L--S--R--D--G--R--Y-
TGAAAACATCAATGTGCTAGATTTATACAGTGGTAAATTGCGGGTGGTTCACGCCTCTGGGATCATCTGGCGGCAGAGGTTGTCTCGGGATGGTCGCTAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-L--V--Y--I--C--F--R--N--G--E--E--E--D--E--N--G--A--I--F--S--L--I--V--M--R--L--A--D--G--K--N--I--G--
CTGGTATACATTTGTTTCCGAAATGGGGAGGAGGAGGATGAAAATGGTGCAATATTCAGTTTAATTGTAATGAGACTGGCAGATGGCAAAAATATCGGTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
A--C--S--L--Y--K--T--P--T--F--L--A--L--S--Q--R--H--L--N--I--I--V--G--F--D--D--G--S--I--G--I--Y--T--V
CTTGTTCCCTTTACAAAACACCAACTTTCCTTGCACTCTCCCAGAGGCACCTGAACATCATTGTGGGCTTTGATGATGGGAGTATAGGGATCTACACGGT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--V--D--R--V--D--A--A--L--K--I--K--I--A--T--S--N--S--R--Q--I--F--N--N--A--T--H--T--S--R--P--K--C--N-
AGTAGACCGTGTAGATGCTGCACTGAAAATCAAAATTGCCACTTCAAATAGCAGACAAATTTTCAACAATGCAACACACACCTCCAGGCCAAAGTGTAAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-S--Y--C--F--K--I--S--V--D--C--L--W--R--E--S--T--E--V--F--A--R--D--S--P--I--T--V--S--D--S--T--E--S--
AGTTATTGTTTTAAAATATCTGTGGATTGCTTATGGAGAGAGTCCACTGAGGTCTTTGCAAGAGACAGCCCCATCACAGTTAGTGACTCTACTGAGTCCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------------------------------------------------------------------------------------------->
N--E--A--T--P--S--K--K--H--N--S--C--Y--E--R--V--C--S--A--L--E--A--R--G--H--S--Y--A--P--D--N--*-
ATGAAGCAACACCCTCCAAGAAACACAACTCTTGTTATGAGCGGGTATGCTCGGCCCTAGAAGCCAGGGGCCACAGCTATGCCCCTGATAACTGA
                                                                                               
-----------------------------------------------------------------------------------------------
-----------------------------------------------------------------------------------------------

Pig Consensus Sequence

>BGISUST0000879867
CAGGTCCTCAAACACCAGCTGCTGCGTGTCAAGAGGAAGGTCACATCGGGCCAGCAGATGTACGTCAACAACGCCTTCTCCAAGTGCACGCTGCCCATGT
TTGTGAACCTGACCTTCCGGGAGGTGAAACACTGGCGATCACACAGGGACGTGGACGAGTCCTCCCTCTGTGTCACCGTTCACGAGAGCATAGAGCAGCT
CTTCTGGTCCCTGGAGAAGAGGTGTGGGCAGATACTTGTCTCCCGGGCTCTTGGTTACATCACCATGGCCAAAATGGGTCTGAGTGAAATGGAGCTGGAG
GACGTGCTGGCCCTTGACAACAGCGTTATGAGCGAGCTCCACGAGGGCGCCAGGCCTGGCAATCCCCTGAGGGTACCTTATCTGTATATCGCGAGGCTCA
AGGAGGGGCTCAGTGGGTACCTAATTGAGAGACACGTGAAAAACGTCACCCTCCTGGTCTGGGCCAACAGACACCTGCAGCTCATCGCCCAGAAGCTGTA
TCTGCAGGACGACCGGGACCTGCGTGAAATGCACACCATCCTGGCTGACTACTTCCTGGGGGTCTGGTCAGGGGGCCGGAGGAAAGCTTTCTGCCTCGAA
GACTCCTACCTGAATGGCTGCCTTGACTTGGAGAGCAGCAGCCTGCTTGATGAAGAAAAGCATTTCATGGAGCAGGCTTCCTTCGACAGGCAGGCCCCAG
ACCAGCCCTGGGTTTTCCAGTGTAACCCACTGGAGCCTGACATCTTCTTTGTCAATCACCGGAAAATGTGTGAGCTCCTG--------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-----------------------------------------------------------------------------------------------


>BGISUSP0000879867
QVLKHQLLRVKRKVTSGQQMYVNNAFSKCTLPMFVNLTFREVKHWRSHRDVDESSLCVTVHESIEQLFWSLEKRCGQILVSRALGYITMAKMGLSEMELE
DVLALDNSVMSELHEGARPGNPLRVPYLYIARLKEGLSGYLIERHVKNVTLLVWANRHLQLIAQKLYLQDDRDLREMHTILADYFLGVWSGGRRKAFCLE
DSYLNGCLDLESSSLLDEEKHFMEQASFDRQAPDQPWVFQCNPLEPDIFFVNHRKMCELL----------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-----------------------------------------------------------------