Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000174343 (click for geneview)
Transcript ID ENST00000310169(link to ensembl)
Symbol CHRNA9
Localtion Chromosome:4:40178397:40197901:1 band: 4p14
Description Neuronal acetylcholine receptor protein, alpha-9 subunit precursor (Nicotinic acetylcholine receptor subunit alpha 9) (NACHR alpha 9). [Source:Uniprot/SWISSPROT;Acc:Q9UGM1]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<--------------------------------------------------------------><-----------------------------------
-M--N--W--S--H--S--C--I--S--F--C--W--I--Y--F--A--A--S--R--L--R--A--A--E--T--A--D--G--K--Y--A--Q--K--
ATGAACTGGTCCCATTCCTGCATCTCCTTTTGCTGGATCTACTTTGCTGCTTCCAGACTGAGAGCTGCAGAGACGGCAGATGGAAAATATGCTCAGAAGT
:::::::::.::::::::::::::::::::::::::::.:::::::::::.:::::::::      :.::: ::.:::::::::::::::::::::::::
ATGAACTGGCCCCATTCCTGCATCTCCTTTTGCTGGATTTACTTTGCTGCCTCCAGACTG------GTAGACACAGCAGATGGAAAATATGCTCAGAAGT
-M--N--W--P--H--S--C--I--S--F--C--W--I--Y--F--A--A--S--R--L--------V--D--T--A--D--G--K--Y--A--Q--K--

----------------------------------------------------------------------------------------------------
L--F--N--D--L--F--E--D--Y--S--N--A--L--R--P--V--E--D--T--D--K--V--L--N--V--T--L--Q--I--T--L--S--Q--I
TGTTTAATGACCTTTTTGAAGATTATTCTAATGCTCTTCGTCCAGTGGAAGATACAGATAAAGTCCTGAATGTGACCCTGCAGATTACGCTCTCTCAGAT
::::::::::::::::::::::::::::.:::::::::::::::::.::.::::::::::::::::::::::: :: :: ::::::::.::.::::::::
TGTTTAATGACCTTTTTGAAGATTATTCCAATGCTCTTCGTCCAGTAGAGGATACAGATAAAGTCCTGAATGTCACGCTCCAGATTACACTTTCTCAGAT
L--F--N--D--L--F--E--D--Y--S--N--A--L--R--P--V--E--D--T--D--K--V--L--N--V--T--L--Q--I--T--L--S--Q--I

---------><-----------------------------------------------------------------------------------------
--K--D--M--D--E--R--N--Q--I--L--T--A--Y--L--W--I--R--Q--I--W--H--D--A--Y--L--T--W--D--R--D--Q--Y--D-
TAAGGATATGGATGAAAGAAACCAAATTCTGACTGCTTATTTGTGGATCCGCCAAATCTGGCACGATGCCTATCTCACGTGGGACCGAGATCAGTACGAT
::::::::::::::::::::::::::::::::::::.:::::.::::::::::::::::::::.::.:: ::::::::::::::. ::::.  :::.:::
TAAGGATATGGATGAAAGAAACCAAATTCTGACTGCCTATTTATGGATCCGCCAAATCTGGCATGACGCATATCTCACGTGGGATAGAGACATGTATGAT
--K--D--M--D--E--R--N--Q--I--L--T--A--Y--L--W--I--R--Q--I--W--H--D--A--Y--L--T--W--D--R--D--M--Y--D-

----------------------------------------------------------------><----------------------------------
-G--L--D--S--I--R--I--P--S--D--L--V--W--R--P--D--I--V--L--Y--N--K--A--D--D--E--S--S--E--P--V--N--T--
GGCCTAGACTCCATCAGGATCCCCAGTGACCTCGTGTGGAGGCCAGACATCGTCTTATATAACAAGGCTGATGATGAATCTTCAGAGCCTGTGAACACCA
:: ::.::::::::::::::::::::.::::: :::::::::::.::.::.:::.:.::::::   ::::::::::: ::::: ::::::::::::::::
GGACTGGACTCCATCAGGATCCCCAGCGACCTGGTGTGGAGGCCGGATATTGTCCTGTATAAC---GCTGATGATGACTCTTCTGAGCCTGTGAACACCA
-G--L--D--S--I--R--I--P--S--D--L--V--W--R--P--D--I--V--L--Y--N-----A--D--D--D--S--S--E--P--V--N--T--

----------------------------------------------------------------------------------------------------
N--V--V--L--R--Y--D--G--L--I--T--W--D--A--P--A--I--T--K--S--S--C--V--V--D--V--T--Y--F--P--F--D--N--Q
ATGTGGTCCTGCGGTATGATGGGCTGATCACCTGGGATGCACCGGCCATCACCAAAAGCTCCTGTGTGGTGGATGTCACCTACTTCCCTTTTGACAACCA
:::::::::::::::::::::::::::::::::::::.:::::.::::::::::::::::::::::::::::::::::::::::::::.:::::. :.::
ATGTGGTCCTGCGGTATGATGGGCTGATCACCTGGGACGCACCAGCCATCACCAAAAGCTCCTGTGTGGTGGATGTCACCTACTTCCCCTTTGATCATCA
N--V--V--L--R--Y--D--G--L--I--T--W--D--A--P--A--I--T--K--S--S--C--V--V--D--V--T--Y--F--P--F--D--H--Q

----------------------------------------------------------------------------------------------------
--Q--C--N--L--T--F--G--S--W--T--Y--N--G--N--Q--V--D--I--F--N--A--L--D--S--G--D--L--S--D--F--I--E--D-
GCAGTGCAACCTGACTTTTGGTTCCTGGACCTACAATGGCAATCAGGTGGACATATTCAACGCCTTGGACAGCGGAGATCTCTCTGACTTCATTGAAGAT
:::::::::::::::.::::::::::::::::::::::::::::::::::::::::::::.:::.:::::::::::::.::::: ::::::::.::.:::
GCAGTGCAACCTGACCTTTGGTTCCTGGACCTACAATGGCAATCAGGTGGACATATTCAATGCCCTGGACAGCGGAGACCTCTCGGACTTCATCGAGGAT
--Q--C--N--L--T--F--G--S--W--T--Y--N--G--N--Q--V--D--I--F--N--A--L--D--S--G--D--L--S--D--F--I--E--D-

----------------------------------------------------------------------------------------------------
-V--E--W--E--V--H--G--M--P--A--V--K--N--V--I--S--Y--G--C--C--S--E--P--Y--P--D--V--T--F--T--L--L--L--
GTGGAATGGGAGGTCCATGGCATGCCCGCTGTGAAGAATGTGATCTCCTATGGCTGCTGCTCTGAGCCTTACCCGGATGTCACATTCACCCTCCTTCTGA
:::::.:::::::::::.:: :::::.:::::::::::.:::::::::::.::::::::::::::::::::::::::.:: ::::::::.::::::::::
GTGGAGTGGGAGGTCCACGGGATGCCTGCTGTGAAGAACGTGATCTCCTACGGCTGCTGCTCTGAGCCTTACCCGGACGTGACATTCACTCTCCTTCTGA
-V--E--W--E--V--H--G--M--P--A--V--K--N--V--I--S--Y--G--C--C--S--E--P--Y--P--D--V--T--F--T--L--L--L--

----------------------------------------------------------------------------------------------------
K--R--R--S--S--F--Y--I--V--N--L--L--I--P--C--V--L--I--S--F--L--A--P--L--S--F--Y--L--P--A--A--S--G--E
AGAGGAGGTCCTCGTTCTATATCGTCAACCTCCTCATCCCATGCGTCCTCATATCTTTTCTGGCTCCTCTGAGTTTTTATCTCCCAGCAGCCTCCGGAGA
::::::::::::: ::::::::::::::.::.:::::.:::::::: ::::::::::::::::::                                   
AGAGGAGGTCCTCTTTCTATATCGTCAATCTTCTCATTCCATGCGTGCTCATATCTTTTCTGGCT-----------------------------------
K--R--R--S--S--F--Y--I--V--N--L--L--I--P--C--V--L--I--S--F--L--A------------------------------------

-------------------------------------------------------------------------------------------------><-
--K--V--S--L--G--V--T--I--L--L--A--M--T--V--F--Q--L--M--V--A--E--I--M--P--A--S--E--N--V--P--L--I--G-
AAAGGTCTCCCTGGGAGTGACCATCCTGTTGGCCATGACTGTATTTCAGCTAATGGTGGCAGAAATCATGCCGGCCTCAGAAAATGTGCCCCTGATAGGT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-K--Y--Y--I--A--T--M--A--L--I--T--A--S--T--A--L--T--I--M--V--M--N--I--H--F--C--G--A--E--A--R--P--V--
AAATACTACATAGCCACGATGGCCCTGATCACAGCCTCCACTGCGTTGACCATCATGGTGATGAATATCCACTTCTGTGGGGCCGAGGCCCGGCCGGTGC
                                                         ::::::::::::::::::::.:::::::::::::::::.::::
---------------------------------------------------------GTGATGAATATCCACTTCTGCGGGGCCGAGGCCCGGCCAGTGC
----------------------------------------------------------V--M--N--I--H--F--C--G--A--E--A--R--P--V--

----------------------------------------------------------------------------------------------------
P--H--W--A--R--V--V--I--L--K--Y--M--S--R--V--L--F--V--Y--D--V--G--E--S--C--L--S--P--H--H--S--R--E--R
CACACTGGGCCAGGGTGGTCATCCTGAAATACATGTCCAGGGTCTTGTTTGTCTATGATGTGGGTGAAAGCTGCCTCAGCCCGCACCACAGTAGAGAGCG
:::::::::: :::::::::::::::::::::::::::::: :::::::::::::.::.::::::::.::::::::..:::: :.::::...::.:::::
CACACTGGGCAAGGGTGGTCATCCTGAAATACATGTCCAGGCTCTTGTTTGTCTACGACGTGGGTGAGAGCTGCCTTGGCCCTCGCCACGACAGGGAGCG
P--H--W--A--R--V--V--I--L--K--Y--M--S--R--L--L--F--V--Y--D--V--G--E--S--C--L--G--P--R--H--D--R--E--R

----------------------------------------------------------------------------------------------------
--D--H--L--T--K--V--Y--S--K--L--P--E--S--N--L--K--A--A--R--N--K--D--L--S--R--K--K--D--M--N--K--R--L-
GGACCACCTCACGAAAGTTTATAGCAAACTCCCAGAGTCTAACCTGAAAGCAGCCAGGAACAAAGACCTTTCCAGAAAGAAGGACATGAACAAACGCTTA
::.::.:::: : ::.::::::.:: :.::.::::::.::.:.::::::.: :::::.::::::::::::.::::::::::::: : :::::::: . ::
GGGCCGCCTCTCCAAGGTTTATGGCCAGCTTCCAGAGCCTGATCTGAAAACTGCCAGAAACAAAGACCTTCCCAGAAAGAAGGAAAGGAACAAACTTGTA
--G--R--L--S--K--V--Y--G--Q--L--P--E--P--D--L--K--T--A--R--N--K--D--L--P--R--K--K--E--R--N--K--L--V-

----------------------------------------------------------------------------------------------------
-K--N--D--L--G--C--Q--G--K--N--P--Q--E--A--E--S--Y--C--A--Q--Y--K--V--L--T--R--N--I--E--Y--I--A--K--
AAGAACGACCTGGGCTGCCAGGGTAAGAACCCTCAGGAGGCCGAGAGTTACTGTGCACAGTACAAAGTGCTGACGAGGAATATTGAGTACATCGCCAAGT
:::::::::.::.: :.:: ::::.::: .:. ::::: ::.:: ::.::::::::::.:::.: ::::.:::::::::::::.::.:::::.:::::::
AAGAACGACTTGAGGTACCCGGGTGAGACTCTGCAGGATGCTGACAGCTACTGTGCACGGTATACAGTGTTGACGAGGAATATCGAATACATTGCCAAGT
-K--N--D--L--R--Y--P--G--E--T--L--Q--D--A--D--S--Y--C--A--R--Y--T--V--L--T--R--N--I--E--Y--I--A--K--

----------------------------------------------------------------------------------------------------
C--L--K--D--H--K--A--T--N--S--K--G--S--E--W--K--K--V--A--K--V--I--D--R--F--F--M--W--I--F--F--I--M--V
GCCTCAAAGACCACAAGGCCACCAATTCCAAGGGGAGTGAATGGAAGAAGGTGGCGAAAGTCATAGACCGATTCTTCATGTGGATTTTTTTCATTATGGT
::::::::::::::::::::::: ::::::::::::::::.:::::.::::: ::.:::::::::::::::::::::::::::.::::::::::::::::
GCCTCAAAGACCACAAGGCCACCCATTCCAAGGGGAGTGAGTGGAAAAAGGTCGCAAAAGTCATAGACCGATTCTTCATGTGGGTTTTTTTCATTATGGT
C--L--K--D--H--K--A--T--H--S--K--G--S--E--W--K--K--V--A--K--V--I--D--R--F--F--M--W--V--F--F--I--M--V

--------------------------------------->
--F--V--M--T--I--L--I--I--A--R--A--D--*-
GTTTGTGATGACTATTTTGATCATAGCAAGAGCGGATTAG
:::::::::::::::::::::::::::::::::.:::   
GTTTGTGATGACTATTTTGATCATAGCAAGAGCAGAT---
--F--V--M--T--I--L--I--I--A--R--A--D----

Pig Consensus Sequence

>BGISUST0000877428
ATGAACTGGCCCCATTCCTGCATCTCCTTTTGCTGGATTTACTTTGCTGCCTCCAGACTG------GTAGACACAGCAGATGGAAAATATGCTCAGAAGT
TGTTTAATGACCTTTTTGAAGATTATTCCAATGCTCTTCGTCCAGTAGAGGATACAGATAAAGTCCTGAATGTCACGCTCCAGATTACACTTTCTCAGAT
TAAGGATATGGATGAAAGAAACCAAATTCTGACTGCCTATTTATGGATCCGCCAAATCTGGCATGACGCATATCTCACGTGGGATAGAGACATGTATGAT
GGACTGGACTCCATCAGGATCCCCAGCGACCTGGTGTGGAGGCCGGATATTGTCCTGTATAAC---GCTGATGATGACTCTTCTGAGCCTGTGAACACCA
ATGTGGTCCTGCGGTATGATGGGCTGATCACCTGGGACGCACCAGCCATCACCAAAAGCTCCTGTGTGGTGGATGTCACCTACTTCCCCTTTGATCATCA
GCAGTGCAACCTGACCTTTGGTTCCTGGACCTACAATGGCAATCAGGTGGACATATTCAATGCCCTGGACAGCGGAGACCTCTCGGACTTCATCGAGGAT
GTGGAGTGGGAGGTCCACGGGATGCCTGCTGTGAAGAACGTGATCTCCTACGGCTGCTGCTCTGAGCCTTACCCGGACGTGACATTCACTCTCCTTCTGA
AGAGGAGGTCCTCTTTCTATATCGTCAATCTTCTCATTCCATGCGTGCTCATATCTTTTCTGGCT-----------------------------------
----------------------------------------------------------------------------------------------------
---------------------------------------------------------GTGATGAATATCCACTTCTGCGGGGCCGAGGCCCGGCCAGTGC
CACACTGGGCAAGGGTGGTCATCCTGAAATACATGTCCAGGCTCTTGTTTGTCTACGACGTGGGTGAGAGCTGCCTTGGCCCTCGCCACGACAGGGAGCG
GGGCCGCCTCTCCAAGGTTTATGGCCAGCTTCCAGAGCCTGATCTGAAAACTGCCAGAAACAAAGACCTTCCCAGAAAGAAGGAAAGGAACAAACTTGTA
AAGAACGACTTGAGGTACCCGGGTGAGACTCTGCAGGATGCTGACAGCTACTGTGCACGGTATACAGTGTTGACGAGGAATATCGAATACATTGCCAAGT
GCCTCAAAGACCACAAGGCCACCCATTCCAAGGGGAGTGAGTGGAAAAAGGTCGCAAAAGTCATAGACCGATTCTTCATGTGGGTTTTTTTCATTATGGT
GTTTGTGATGACTATTTTGATCATAGCAAGAGCAGAT---


>BGISUSP0000877428
MNWPHSCISFCWIYFAASRL--VDTADGKYAQKLFNDLFEDYSNALRPVEDTDKVLNVTLQITLSQIKDMDERNQILTAYLWIRQIWHDAYLTWDRDMYD
GLDSIRIPSDLVWRPDIVLYN-ADDDSSEPVNTNVVLRYDGLITWDAPAITKSSCVVDVTYFPFDHQQCNLTFGSWTYNGNQVDIFNALDSGDLSDFIED
VEWEVHGMPAVKNVISYGCCSEPYPDVTFTLLLKRRSSFYIVNLLIPCVLISFLA---------------------------------------------
-------------------VMNIHFCGAEARPVPHWARVVILKYMSRLLFVYDVGESCLGPRHDRERGRLSKVYGQLPEPDLKTARNKDLPRKKERNKLV
KNDLRYPGETLQDADSYCARYTVLTRNIEYIAKCLKDHKATHSKGSEWKKVAKVIDRFFMWVFFIMVFVMTILIIARAD-