Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000173811 (click for geneview)
Transcript ID ENST00000310232(link to ensembl)
Symbol CCDC13
Localtion Chromosome:3:42724884:42789748:-1 band: 3p22.1
Description Coiled-coil domain containing protein 13. [Source:Uniprot/SWISSPROT;Acc:Q8IYE1]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--A--A--D--E--S--S--Q--N--T--L--R--L--Q--F--K--A--M--Q--E--M--Q--H--K--R--L--Q--K--Q--M--E--K--K--
ATGGCAGCAGATGAAAGCTCACAGAACACTTTGCGGCTCCAGTTCAAGGCAATGCAGGAGATGCAGCACAAACGGTTACAGAAGCAGATGGAGAAAAAGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
R--E--K--E--L--S--L--K--S--R--A--D--D--Q--E--E--P--L--E--V--S--D--G--L--S--L--L--H--A--G--E--P--N--S
GGGAAAAAGAACTGAGCCTCAAAAGCAGAGCTGACGACCAAGAGGAGCCCTTGGAGGTTTCAGATGGCCTCAGCCTTCTCCACGCAGGGGAGCCAAACTC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------><------------------------------------------------------------------------------
--K--N--S--F--E--K--R--V--L--E--D--E--I--E--H--L--R--N--E--L--R--E--T--V--D--E--N--G--R--L--Y--K--L-
GAAAAATAGCTTTGAGAAGAGGGTGCTTGAAGATGAGATTGAACACCTTCGAAATGAGCTCAGGGAAACGGTGGACGAGAACGGGCGATTGTATAAGCTG
                      :::::::::::::::::. :::: :: ::..:: :.:::::::::::.:::::.::::::::::::::::::::::::
----------------------GTGCTTGAAGATGAGATCCAACAGCTGCGGGATCAACTCAGGGAAACAGTGGATGAGAACGGGCGATTGTATAAGCTG
-----------------------V--L--E--D--E--I--Q--Q--L--R--D--Q--L--R--E--T--V--D--E--N--G--R--L--Y--K--L-

---------------------------------------------------------------------><-----------------------------
-L--K--E--R--D--F--E--I--K--H--L--K--K--K--I--E--E--D--R--F--A--F--T--G--T--A--G--V--A--G--D--V--V--
CTGAAGGAAAGGGACTTTGAAATCAAACACCTCAAAAAGAAAATAGAAGAGGACAGATTTGCCTTCACAGGGACAGCCGGTGTAGCCGGAGACGTGGTCG
::.:::::.:::::.::::::::::::::::::::::::::.:::::::::::::::::.:::                                     
CTAAAGGAGAGGGATTTTGAAATCAAACACCTCAAAAAGAAGATAGAAGAGGACAGATTCGCC-------------------------------------
-L--K--E--R--D--F--E--I--K--H--L--K--K--K--I--E--E--D--R--F--A--------------------------------------

----------------------------------------------------------------------------------------------------
A--T--K--I--V--E--L--S--K--K--N--R--L--L--M--A--E--S--E--G--A--K--T--R--V--K--Q--L--T--N--R--I--Q--E
CCACCAAAATTGTGGAGCTATCAAAAAAGAACCGGCTGTTGATGGCAGAATCAGAGGGTGCAAAAACCAGGGTGAAGCAGCTGACCAATCGCATCCAGGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------><--------------------------------------------------------------------------------------
--L--E--R--E--L--Q--T--A--L--T--R--L--S--A--K--G--A--T--D--A--G--A--K--P--P--R--A--Q--M--G--D--R--A-
GCTGGAGCGGGAACTGCAGACAGCCCTGACCAGGCTGTCAGCCAAGGGGGCCACCGACGCAGGAGCCAAGCCACCGAGGGCCCAGATGGGAGACAGAGCA
             ::::::::.::::: .::::..::.::::::::::::::::::::::::::.::::::: :.::::::::::::::::::::::.. 
-------------CTGCAGACGGCCCTTGCCAGATTGCCAGCCAAGGGGGCCACCGACGCAGGAACCAAGCCTCTGAGGGCCCAGATGGGAGACAGAATC
--------------L--Q--T--A--L--A--R--L--P--A--K--G--A--T--D--A--G--T--K--P--L--R--A--Q--M--G--D--R--I-

--><------------------------------------------------------------------------------------------------
-L--L--E--T--P--E--V--K--A--L--Q--D--R--L--V--A--T--N--L--K--M--S--D--L--R--N--Q--I--Q--S--V--K--Q--
TTGCTGGAGACCCCAGAGGTGAAGGCCCTGCAGGACAGGCTGGTGGCCACCAACTTGAAGATGAGTGACCTCCGAAACCAGATCCAGTCTGTGAAGCAGG
:::   :::: ::::::::::::::.:.:::::::::::::::.:::.:: :::.::::::::::::::::::: :::::::::::: ::::::::::::
TTG---GAGAGCCCAGAGGTGAAGGTCTTGCAGGACAGGCTGGCGGCTACAAACCTGAAGATGAGTGACCTCCGCAACCAGATCCAGGCTGTGAAGCAGG
-L-----E--S--P--E--V--K--V--L--Q--D--R--L--A--A--T--N--L--K--M--S--D--L--R--N--Q--I--Q--A--V--K--Q--

-------------------><-------------------------------------------------------------------------------
E--L--R--M--A--Q--K--V--L--A--R--E--V--G--E--D--I--N--V--Q--Q--L--L--S--S--P--G--T--W--R--G--R--A--Q
AGCTGCGGATGGCACAGAAGGTTTTGGCCAGAGAGGTTGGGGAAGACATCAACGTTCAGCAGCTCCTATCTTCGCCAGGGACCTGGAGGGGTCGGGCTCA
:::: :::::.:: ::::::::::::.:::: ::::::::::::::..: :::.:.:::::::::::.::.:: :: ::  :::::::::::::::::::
AGCTCCGGATAGCCCAGAAGGTTTTGACCAGTGAGGTTGGGGAAGATGTGAACATCCAGCAGCTCCTGTCCTCTCCTGGCTCCTGGAGGGGTCGGGCTCA
E--L--R--I--A--Q--K--V--L--T--S--E--V--G--E--D--V--N--I--Q--Q--L--L--S--S--P--G--S--W--R--G--R--A--Q

------------------------><--------------------------------------------------------------------------
--Q--I--L--V--L--Q--S--K--V--Q--E--L--E--K--Q--L--G--Q--A--R--S--Q--S--A--G--T--A--S--D--E--L--S--V-
ACAAATTCTTGTTTTGCAGAGCAAGGTTCAAGAGCTTGAGAAGCAATTGGGCCAGGCCCGGAGCCAGTCTGCGGGAACAGCCAGTGATGAGTTGTCTGTC
.:::::.::.::.::::::::::::::::.:::::::::::..::..:::: :::.::::::::::::::...:.::::::::::::::::.::.:::.:
GCAAATCCTCGTCTTGCAGAGCAAGGTTCGAGAGCTTGAGAGACAGCTGGGACAGACCCGGAGCCAGTCTATAGAAACAGCCAGTGATGAGCTGCCTGCC
--Q--I--L--V--L--Q--S--K--V--R--E--L--E--R--Q--L--G--Q--T--R--S--Q--S--I--E--T--A--S--D--E--L--P--A-

--------------------------------------------------------------------------------------><------------
-Y--P--D--P--R--K--L--S--A--Q--E--K--N--L--L--R--I--R--S--L--E--R--E--K--Q--E--G--L--E--K--L--A--S--
TATCCAGACCCAAGGAAGCTGTCGGCACAGGAGAAAAACCTGCTGAGGATCCGCAGCCTGGAAAGGGAAAAACAGGAAGGCTTGGAGAAACTTGCCAGTG
.::::::::::::::::::::::.::::::::::::::::::.::::::::::::.::::::.::.:::::::::::::::: ::::             
CATCCAGACCCAAGGAAGCTGTCAGCACAGGAGAAAAACCTGTTGAGGATCCGCAACCTGGAGAGAGAAAAACAGGAAGGCTGGGAG-------------
-H--P--D--P--R--K--L--S--A--Q--E--K--N--L--L--R--I--R--N--L--E--R--E--K--Q--E--G--W--E--------------

----------------------------------------------------------------------------------------------------
E--R--D--V--L--Q--R--E--L--E--E--L--K--K--K--F--E--G--M--R--S--R--N--K--L--L--S--S--E--M--K--T--L--K
AACGGGATGTCCTCCAGAGAGAGCTTGAAGAGCTAAAAAAGAAGTTCGAGGGCATGAGGTCTCGGAACAAGCTGCTGTCAAGTGAGATGAAGACCCTCAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------------------------------------------------------------><-----------------------------------
--S--Q--M--G--T--L--V--E--K--G--R--H--D--D--E--L--I--D--A--L--M--D--Q--L--K--Q--L--Q--E--I--L--G--S-
GAGTCAGATGGGAACCCTGGTGGAGAAGGGCCGGCATGATGACGAGCTCATCGACGCCCTCATGGACCAGCTGAAGCAGCTACAGGAGATCCTAGGCAGC
                                                                ::::::::::.::::::::::::::: ::.::::::
----------------------------------------------------------------GACCAGCTGAGGCAGCTACAGGAGATACTGGGCAGC
-----------------------------------------------------------------D--Q--L--R--Q--L--Q--E--I--L--G--S-

----------------------------------------------------------------------------------------------------
-L--S--L--Q--E--E--K--T--R--V--S--Q--H--H--L--D--Q--Q--L--N--S--E--A--Q--R--S--N--S--L--V--A--Q--L--
CTGAGTCTGCAGGAGGAGAAAACGCGAGTGTCCCAGCACCACCTGGACCAGCAACTGAACAGCGAGGCTCAGCGGAGCAACAGCCTAGTCGCCCAGCTGC
::::::::.::::::::.::.::.:::::::::::::::::::::::::::::.:: ::::.:::::::::::::::::.:::::: :: ::::::::::
CTGAGTCTACAGGAGGAAAAGACACGAGTGTCCCAGCACCACCTGGACCAGCAGCTCAACAACGAGGCTCAGCGGAGCAGCAGCCTTGTGGCCCAGCTGC
-L--S--L--Q--E--E--K--T--R--V--S--Q--H--H--L--D--Q--Q--L--N--N--E--A--Q--R--S--S--S--L--V--A--Q--L--

-------------------------------------------------------------------------><-------------------------
Q--A--M--V--A--E--R--E--A--K--V--R--Q--L--E--M--E--I--G--Q--L--N--V--H--Y--L--R--N--K--G--V--G--E--G
AGGCCATGGTAGCTGAGCGGGAGGCCAAAGTGCGACAGCTGGAGATGGAGATCGGACAACTCAATGTGCACTATCTTCGGAATAAAGGAGTGGGTGAGGG
.:::::::::.::::::::::: :::::.:::::.:::                                 ::::::::::::::::::::.::::::::
GGGCCATGGTGGCTGAGCGGGA-GCCAAGGTGCGGCAG---------------------------------TATCTTCGGAATAAAGGAGTAGGTGAGGG
R--A--M--V--A--E--R--E--A--K--V--R--Q-----------------------------------Y--L--R--N--K--G--V--G--E--G

----------------------------------------------------------------------------------------------------
--S--S--G--R--E--V--S--P--A--Y--T--Q--F--L--E--D--P--G--L--T--K--S--P--A--S--A-----G--D--H--V--G--R-
GTCCAGTGGCCGCGAGGTCAGCCCTGCCTATACCCAGTTCCTGGAGGACCCAGGCCTGACCAAGTCCCCGGCCTCAGCA---GGCGATCATGTTGGCAGG
::::::::: : .:::::::.:::::::   ::: ::::::. .: ::.:..::::::.:::.::::::.:::::::::   ::.:::::.:.:::::::
GTCCAGTGGGCCTGAGGTCAACCCTGCCAC-ACCAAGTTCCCCAATGATCTGGGCCTGGCCAGGTCCCCAGCCTCAGCAGCAGGTGATCACGCTGGCAGG
--S--S--G--P--E--V--N--P--A--Y--T--K--F--P--N--D--L--G--L--A--R--S--P--A--S--A--A--G--D--H--A--G--R-

-------------------><-------------------------------------------------------------------------------
-L--G--S--S--R--S--V--T--S--L--G--H--T--L--V--E--S--A--L--T--R--P--S--L--P--S--P--H--R--T--S--P--R--
CTTGGATCTTCTCGCTCTGTGACCAGCCTGGGCCACACACTGGTGGAATCTGCTCTCACGAGGCCTTCCCTGCCCAGTCCCCACAGGACCTCACCTAGGT
:::::::::                                                                                           
CTTGGATCT-------------------------------------------------------------------------------------------
-L--G--S--------------------------------------------------------------------------------------------

---><-----------------------------------------------------------------------------------------------
F--S--D--S--P--E--Q--K--G--W--Q--A--Q--V--S--E--I--K--A--L--W--Q--A--A--E--V--E--R--D--R--L--T--E--F
TCTCGGACTCCCCAGAACAAAAAGGCTGGCAGGCACAAGTGTCAGAGATCAAGGCCCTCTGGCAGGCTGCCGAGGTGGAGCGTGACCGGCTCACCGAGTT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------------><------------------------------------------------------------------------
--V--T--V--L--Q--K--R--V--E--E--S--N--S--K--L--L--E--S--E--R--K--L--Q--E--E--R--H--R--T--V--V--L--E-
TGTCACTGTCCTGCAGAAACGGGTGGAGGAGAGCAACAGCAAGCTCCTGGAGTCAGAGAGGAAGCTGCAGGAGGAGCGACACCGCACCGTGGTGCTGGAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------------------------------------------------------------------------------><-----------------
-Q--H--L--E--K--I--R--L--E--P--G--K--A--S--A--S--Q--R--A--A--P--R--T--K--T--G--L--P--T--S--N--N--R--
CAACATCTGGAGAAGATACGCCTGGAGCCAGGGAAGGCATCAGCCTCCCAGAGAGCAGCTCCCAGGACCAAAACAGGTCTGCCCACCTCTAACAACAGGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------------------------------------------------------------------------------------------><--
H--N--P--T--G--S--E--K--K--D--P--S--F--A--Q--L--S--D--V--P--V--E--S--Q--M--E--E--L--T--T--R--L--A--I
ACAACCCAACCGGGAGCGAGAAGAAGGACCCATCCTTTGCCCAGCTCTCCGATGTGCCCGTGGAATCCCAAATGGAAGAGCTGACAACCAGGCTGGCCAT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--Q--V--E--E--N--E--M--L--K--A--A--L--G--S--A--L--R--G--K--E--E--D--F--R--M--Y--H--E--I--L--G--Q--V-
CCAGGTGGAGGAGAATGAAATGCTAAAGGCTGCCCTGGGCAGTGCCCTGCGGGGAAAGGAGGAGGACTTCCGGATGTACCATGAGATCCTGGGCCAGGTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------------------------------------------------
-K--S--V--F--L--Q--A--L--R--Q--Q--K--T--G--K--Q--*-
AAAAGTGTCTTCCTGCAGGCCCTGCGGCAGCAGAAGACAGGCAAGCAATAG
                                                   
---------------------------------------------------
---------------------------------------------------

Pig Consensus Sequence

>BGISUST0000885088
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------GTGCTTGAAGATGAGATCCAACAGCTGCGGGATCAACTCAGGGAAACAGTGGATGAGAACGGGCGATTGTATAAGCTG
CTAAAGGAGAGGGATTTTGAAATCAAACACCTCAAAAAGAAGATAGAAGAGGACAGATTCGCC-------------------------------------
----------------------------------------------------------------------------------------------------
-------------CTGCAGACGGCCCTTGCCAGATTGCCAGCCAAGGGGGCCACCGACGCAGGAACCAAGCCTCTGAGGGCCCAGATGGGAGACAGAATC
TTG---GAGAGCCCAGAGGTGAAGGTCTTGCAGGACAGGCTGGCGGCTACAAACCTGAAGATGAGTGACCTCCGCAACCAGATCCAGGCTGTGAAGCAGG
AGCTCCGGATAGCCCAGAAGGTTTTGACCAGTGAGGTTGGGGAAGATGTGAACATCCAGCAGCTCCTGTCCTCTCCTGGCTCCTGGAGGGGTCGGGCTCA
GCAAATCCTCGTCTTGCAGAGCAAGGTTCGAGAGCTTGAGAGACAGCTGGGACAGACCCGGAGCCAGTCTATAGAAACAGCCAGTGATGAGCTGCCTGCC
CATCCAGACCCAAGGAAGCTGTCAGCACAGGAGAAAAACCTGTTGAGGATCCGCAACCTGGAGAGAGAAAAACAGGAAGGCTGGGAG-------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------GACCAGCTGAGGCAGCTACAGGAGATACTGGGCAGC
CTGAGTCTACAGGAGGAAAAGACACGAGTGTCCCAGCACCACCTGGACCAGCAGCTCAACAACGAGGCTCAGCGGAGCAGCAGCCTTGTGGCCCAGCTGC
GGGCCATGGTGGCTGAGCGggCCAAGGTGCGGCAG---------------------------------TATCTTCGGAATAAAGGAGTAGGTGAGGGGTC
CAGTGGGCCTGAGGTCAACCCTGCcaCCAAGTTCCCCAATGATCTGGGCCTGGCCAGGTCCCCAGCCTCAGCAGCAGGTGATCACGCTGGCAGGCTTGGA
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
------------------------------------------


>BGISUSP0000885088
--------------------------------------------------------------------------VLEDEIQQLRDQLRETVDENGRLYKL
LKERDFEIKHLKKKIEEDRFA--------------------------------------------------LQTALARLPAKGATDAGTKPLRAQMGDRI
L-ESPEVKVLQDRLAATNLKMSDLRNQIQAVKQELRIAQKVLTSEVGEDVNIQQLLSSPGSWRGRAQQILVLQSKVRELERQLGQTRSQSIETASDELPA
HPDPRKLSAQEKNLLRIRNLEREKQEGWE-----------------------------------------------------------DQLRQLQEILGS
LSLQEEKTRVSQHHLDQQLNNEAQRSSSLVAQLRAMVAERAKVRQ-----------YLRNKGVGEGSSGPEVNPATKFPNDLGLARSPASAAGDHAGRLG
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
--------------