Sequences
EST Library Info
pgl2Pituitary gland
ute3Uterus
Clusters
Oligos
SNPs

Gene ID ENSG00000174151 (click for geneview)
Transcript ID ENST00000310611(link to ensembl)
Symbol CYB561D1
Localtion Chromosome:1:109748763:109755097:1 band: 1p13.3
Description Cytochrome b561 domain containing protein 1. [Source:Uniprot/SWISSPROT;Acc:Q8N8Q1]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--Q--P--L--E--V--G--L--V--P--A--P--A--G--E--P--R--L--T--R--W--L--R--R--G--S--G--I--L--A--H--L--V--
ATGCAGCCCCTGGAGGTAGGTCTGGTTCCCGCTCCAGCTGGGGAGCCGAGACTGACCCGCTGGCTGCGGAGAGGCAGTGGGATCTTGGCGCACCTGGTAG
::::.::::::::::::::::::::::::::::::. : .:::::::::::::::: ::.::::::::::::::: :::::::::::::.:::::::: :
ATGCGGCCCCTGGAGGTAGGTCTGGTTCCCGCTCCGCCGAGGGAGCCGAGACTGACGCGTTGGCTGCGGAGAGGCTGTGGGATCTTGGCACACCTGGTCG
-M--R--P--L--E--V--G--L--V--P--A--P--P--R--E--P--R--L--T--R--W--L--R--R--G--C--G--I--L--A--H--L--V--

-----------------------------------------------><------------------------------------><-------------
A--L--G--F--T--I--F--L--T--A--L--S--R--P--G--T--S--L--F--S--W--H--P--V--F--M--A--L--A--F--C--L--C--M
CTTTGGGCTTCACCATCTTTCTGACAGCGCTGTCCCGGCCAGGAACCAGTCTTTTCTCCTGGCACCCTGTATTCATGGCCTTGGCGTTCTGCCTCTGCAT
::::::::::::::::::::::::: :.::::::::::::.::::::   .:::::::::::::::::::::::::::::::::::::::::::::::::
CTTTGGGCTTCACCATCTTTCTGACTGTGCTGTCCCGGCCGGGAACC---TTTTTCTCCTGGCACCCTGTATTCATGGCCTTGGCGTTCTGCCTCTGCAT
A--L--G--F--T--I--F--L--T--V--L--S--R--P--G--T-----F--F--S--W--H--P--V--F--M--A--L--A--F--C--L--C--M

----------------------------------------------------------------------------------------------------
--A--E--A--I--L--L--F--S--P--E--H--S--L--F--F--F--C--S--R--K--A--R--I--R--L--H--W--A--G--Q--T--L--A-
GGCTGAAGCCATCCTACTCTTCTCACCTGAACACTCCCTGTTCTTCTTCTGCTCCCGAAAAGCACGGATCCGGCTCCACTGGGCAGGGCAGACCCTAGCC
::::::.:::::::::::::::::.:::::.:::::::.:::::::::::::::::::::.:. ::::::::.:::::.:::::::::::::::::::::
GGCTGAGGCCATCCTACTCTTCTCGCCTGAGCACTCCCCGTTCTTCTTCTGCTCCCGAAAGGTCCGGATCCGACTCCATTGGGCAGGGCAGACCCTAGCC
--A--E--A--I--L--L--F--S--P--E--H--S--P--F--F--F--C--S--R--K--V--R--I--R--L--H--W--A--G--Q--T--L--A-

----------------------------------------------------------------------------------------------------
-I--L--C--A--A--L--G--L--G--F--I--I--S--S--R--T--R--S--E--L--P--H--L--V--S--W--H--S--W--V--G--A--L--
ATCCTCTGTGCAGCTCTGGGCCTGGGCTTCATCATCTCCAGCAGGACCCGCAGTGAGCTGCCTCATCTGGTGTCCTGGCACAGCTGGGTGGGAGCCCTGA
::::::::::::::.::::::::::::::::::.::::::::::::::::::::::::::::.::.:::::::::::::::::::::::.::.::.::::
ATCCTCTGTGCAGCCCTGGGCCTGGGCTTCATCGTCTCCAGCAGGACCCGCAGTGAGCTGCCCCACCTGGTGTCCTGGCACAGCTGGGTAGGGGCTCTGA
-I--L--C--A--A--L--G--L--G--F--I--V--S--S--R--T--R--S--E--L--P--H--L--V--S--W--H--S--W--V--G--A--L--

----------------------------------------------------------------------------------------------------
T--L--L--A--T--A--V--Q--A--L--C--G--L--C--L--L--C--P--R--A--A--R--V--S--R--V--A--R--L--K--L--Y--H--L
CACTGCTGGCCACTGCTGTCCAGGCACTGTGTGGGCTCTGCCTCCTTTGTCCCCGGGCAGCCAGGGTCTCAAGGGTGGCTCGCCTCAAGCTCTACCATCT
::.:.:::::::::: :: :::::::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::::::::::::::::::
CATTACTGGCCACTGGTGGCCAGGCACTGTGTGGGCTCTGCCTCCTCTGTCCCCGGGCAGCCAGGGTCTCAAGGGTGGCTCGCCTCAAGCTCTACCATCT
T--L--L--A--T--G--G--Q--A--L--C--G--L--C--L--L--C--P--R--A--A--R--V--S--R--V--A--R--L--K--L--Y--H--L

----------------------------------------------------------------------------------------------------
--T--C--G--L--V--V--Y--L--M--A--T--V--T--V--L--L--G--M--Y--S--V--W--F--Q--A--Q--I--K--G--A--A--W--Y-
GACATGTGGACTGGTGGTCTACCTGATGGCTACAGTAACGGTGCTTCTGGGCATGTACTCAGTATGGTTCCAGGCCCAGATCAAAGGTGCGGCCTGGTAC
::: :::::::::::::::::::::::::::::.::::::::.::.:::::: ::.:::: ::.::::::::::::::::::::::.:::.:::::::::
GACTTGTGGACTGGTGGTCTACCTGATGGCTACGGTAACGGTACTCCTGGGCCTGCACTCTGTGTGGTTCCAGGCCCAGATCAAAGATGCAGCCTGGTAC
--T--C--G--L--V--V--Y--L--M--A--T--V--T--V--L--L--G--L--H--S--V--W--F--Q--A--Q--I--K--D--A--A--W--Y-

----------------------------------------------------------------------------------------->
-L--C--L--A--L--P--V--Y--P--A--L--V--I--M--H--Q--I--S--R--S--Y--L--P--R--K--K--M--E--M--*-
CTGTGCCTGGCACTGCCCGTCTATCCAGCCCTGGTGATCATGCACCAGATTTCCAGATCCTACTTGCCGAGGAAGAAAATGGAAATGTGA
:::::::::::.:::::: ::::::::::::::::.::::::::.:::::.::::: :::::::::::.:::::::::::::::::::::
CTGTGCCTGGCGCTGCCCCTCTATCCAGCCCTGGTAATCATGCATCAGATCTCCAGCTCCTACTTGCCAAGGAAGAAAATGGAAATGTGA
-L--C--L--A--L--P--L--Y--P--A--L--V--I--M--H--Q--I--S--S--S--Y--L--P--R--K--K--M--E--M--*-

Pig Consensus Sequence

>BGISUST0000890162
ATGCGGCCCCTGGAGGTAGGTCTGGTTCCCGCTCCGCCGAGGGAGCCGAGACTGACGCGTTGGCTGCGGAGAGGCTGTGGGATCTTGGCACACCTGGTCG
CTTTGGGCTTCACCATCTTTCTGACTGTGCTGTCCCGGCCGGGAACC---TTTTTCTCCTGGCACCCTGTATTCATGGCCTTGGCGTTCTGCCTCTGCAT
GGCTGAGGCCATCCTACTCTTCTCGCCTGAGCACTCCCCGTTCTTCTTCTGCTCCCGAAAGGTCCGGATCCGACTCCATTGGGCAGGGCAGACCCTAGCC
ATCCTCTGTGCAGCCCTGGGCCTGGGCTTCATCGTCTCCAGCAGGACCCGCAGTGAGCTGCCCCACCTGGTGTCCTGGCACAGCTGGGTAGGGGCTCTGA
CATTACTGGCCACTGGTGGCCAGGCACTGTGTGGGCTCTGCCTCCTCTGTCCCCGGGCAGCCAGGGTCTCAAGGGTGGCTCGCCTCAAGCTCTACCATCT
GACTTGTGGACTGGTGGTCTACCTGATGGCTACGGTAACGGTACTCCTGGGCCTGCACTCTGTGTGGTTCCAGGCCCAGATCAAAGATGCAGCCTGGTAC
CTGTGCCTGGCGCTGCCCCTCTATCCAGCCCTGGTAATCATGCATCAGATCTCCAGCTCCTACTTGCCAAGGAAGAAAATGGAAATGTGA


>BGISUSP0000890162
MRPLEVGLVPAPPREPRLTRWLRRGCGILAHLVALGFTIFLTVLSRPGT-FFSWHPVFMALAFCLCMAEAILLFSPEHSPFFFCSRKVRIRLHWAGQTLA
ILCAALGLGFIVSSRTRSELPHLVSWHSWVGALTLLATGGQALCGLCLLCPRAARVSRVARLKLYHLTCGLVVYLMATVTVLLGLHSVWFQAQIKDAAWY
LCLALPLYPALVIMHQISSSYLPRKKMEM*