Sequences
EST Library Info
nje4Newborn 115 days, jejunum
Clusters
Oligos
SNPs

Gene ID ENSG00000184227 (click for geneview)
Transcript ID ENST00000311148(link to ensembl)
Symbol CTE1_HUMAN
Localtion Chromosome:14:73073571:73080206:1 band: 14q24.3
Description Cytosolic acyl coenzyme A thioester hydrolase, inducible (EC 3.1.2.2) (Long chain acyl-CoA thioester hydrolase) (Long chain acyl-CoA hydrolase) (CTE-I) (CTE-Ib).
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--A--A--T--L--I--L--E--P--A--G--R--C--C--W--D--E--P--V--R--I--A--V--R--G--L--A--P--E--Q--P--V--T--
ATGGCGGCGACGCTGATCCTGGAGCCCGCGGGCCGCTGCTGCTGGGACGAACCGGTGCGAATCGCCGTGCGCGGCCTAGCCCCGGAGCAGCCGGTCACGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
L--R--A--S--L--R--D--E--K--G--A--L--F--Q--A--H--A--R--Y--R--A--D--T--L--G--E--L--D--L--E--R--A--P--A
TGCGCGCGTCCCTGCGCGACGAGAAGGGCGCGCTTTTCCAGGCCCACGCGCGCTACCGCGCCGACACCCTTGGCGAGCTGGACCTGGAGCGCGCGCCCGC
              ::::::::::::::::::::.::: .::::::::::::::::.:::::::::::  .::: :::::::::::: ::::::::::::
--------------CGCGACGAGAAGGGCGCGCTCTTCAGGGCCCACGCGCGCTACTGCGCCGACACCGACGGCCAGCTGGACCTGGCGCGCGCGCCCGC
---------------R--D--E--K--G--A--L--F--R--A--H--A--R--Y--C--A--D--T--D--G--Q--L--D--L--A--R--A--P--A

----------------------------------------------------------------------------------------------------
--L--G--G--S--F--A--G--L--E--P--M--G--L--L--W--A--L--E--P--E--K--P--L--V--R--L--V--K--R--D--V--R--T-
GCTGGGCGGCAGCTTCGCGGGGCTTGAGCCCATGGGGCTGCTCTGGGCCTTGGAGCCCGAGAAACCCTTGGTGCGGCTGGTGAAGCGCGACGTGCGAACG
:::::::::::::::::.::::::.:::::::::::::: .:::::::..:::::::::::::.::.::: :.:::::::::::::: :::::::..:::
GCTGGGCGGCAGCTTCGTGGGGCTCGAGCCCATGGGGCTCTTCTGGGCTCTGGAGCCCGAGAAGCCTTTGCTACGGCTGGTGAAGCGGGACGTGCAGACG
--L--G--G--S--F--V--G--L--E--P--M--G--L--F--W--A--L--E--P--E--K--P--L--L--R--L--V--K--R--D--V--Q--T-

----------------------------------------------------------------------------------------------------
-P--L--A--V--E--L--E--V--L--D--G--H--D--P--D--P--G--R--L--L--C--R--V--R--H--E--R--Y--F--L--P--P--G--
CCCTTGGCCGTGGAGCTGGAGGTGCTGGATGGCCACGACCCCGACCCCGGGCGGCTGCTGTGCCGGGTGCGGCACGAGCGCTACTTCCTCCCGCCCGGGG
::::: ::::::::::::::::::.: ::.:::::::: :::::   ::::::::: ::: ::::::.   :::::::::: ::::::: ::::::::::
CCCTTCGCCGTGGAGCTGGAGGTGTTCGACGGCCACGAGCCCGAGGGCGGGCGGCTCCTGGGCCGGGCTGTGCACGAGCGCGACTTCCTGCCGCCCGGGG
-P--F--A--V--E--L--E--V--F--D--G--H--E--P--E--G--G--R--L--L--G--R--A--V--H--E--R--D--F--L--P--P--G--

--------------------------------------------------------><------------------------------------------
V--R--R--E--P--V--R--A--G--R--V--R--G--T--L--F--L--P--P--E--P--G--P--F--P--G--I--V--D--M--F--G--T--G
TGCGGCGCGAGCCGGTGCGCGCGGGCCGGGTGCGAGGCACGCTCTTCCTGCCGCCAGAACCTGGGCCCTTTCCTGGCATTGTGGACATGTTCGGAACTGG
: :::::::::::::::::::::::::::::::: : ::::::.:::::::: :::   ::::: ::::::::::: ::.:::::: : ::.:::.::::
TTCGGCGCGAGCCGGTGCGCGCGGGCCGGGTGCGCGCCACGCTTTTCCTGCCTCCA---CCTGGCCCCTTTCCTGGGATCGTGGACCTTTTTGGAGCTGG
V--R--R--E--P--V--R--A--G--R--V--R--A--T--L--F--L--P--P-----P--G--P--F--P--G--I--V--D--L--F--G--A--G

----------------------------------------------------------------------------------------------------
--G--G--L--L--E--Y--R--A--S--L--L--A--G--K--G--F--A--V--M--A--L--A--Y--Y--N--Y--E--D--L--P--K--T--M-
AGGTGGCCTGCTGGAGTATCGGGCTAGTCTGCTGGCTGGGAAGGGTTTTGCTGTGATGGCTCTGGCTTACTATAACTATGAAGACCTCCCCAAGACCATG
::: ::::: :..::.::.::.::.::::::::::::::.:::::::::::::::::::: ::::::::..:::::::.::::::::::::::.. :::.
AGGGGGCCTTCCAGAATACCGAGCCAGTCTGCTGGCTGGAAAGGGTTTTGCTGTGATGGCGCTGGCTTATCATAACTACGAAGACCTCCCCAAAGGCATA
--G--G--L--P--E--Y--R--A--S--L--L--A--G--K--G--F--A--V--M--A--L--A--Y--H--N--Y--E--D--L--P--K--G--I-

-----------------------------------------------------------><---------------------------------------
-E--T--L--H--L--E--Y--F--E--E--A--V--N--Y--L--L--S--H--P--E--V--K--G--P--G--V--G--L--L--G--I--S--K--
GAGACGCTCCATCTGGAGTACTTTGAAGAAGCTGTGAACTACTTGCTCAGTCATCCTGAGGTAAAAGGTCCAGGAGTTGGGCTGCTTGGAATTTCCAAAG
::::   ::::.:::::::::::::::::::::::::::::::::::.:::::.::: ::                                        
GAGAATGTCCACCTGGAGTACTTTGAAGAAGCTGTGAACTACTTGCTTAGTCACCCTCAG----------------------------------------
-E--N--V--H--L--E--Y--F--E--E--A--V--N--Y--L--L--S--H--P--Q-----------------------------------------

----------------------------------------------------------------------------------------------------
G--G--E--L--C--L--S--M--A--S--F--L--K--G--I--T--A--A--V--V--I--N--G--S--V--A--N--V--G--G--T--L--R--Y
GGGGTGAGCTCTGCCTTTCCATGGCCTCTTTCCTGAAGGGCATCACGGCTGCTGTCGTCATCAACGGCTCTGTGGCCAATGTTGGGGGAACCTTACGCTA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--K--G--E--T--L--P--P--V--G--V--N--R--N--R--I--K--V--T--K--D--G--Y--A--D--I--V--D--V--L--N--S--P--L-
CAAGGGCGAGACCCTGCCCCCTGTGGGCGTCAACAGAAATCGCATCAAGGTGACCAAAGATGGCTATGCAGACATTGTGGATGTCCTGAACAGCCCTTTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-E--G--P--D--Q--K--S--F--I--P--V--E--R--A--E--S--T--F--L--F--L--V--G--Q--D--D--H--N--W--K--S--E--F--
GAAGGACCTGACCAGAAGAGCTTCATTCCTGTGGAAAGGGCAGAGAGCACCTTCCTGTTCCTGGTAGGTCAGGATGACCACAACTGGAAGAGTGAGTTCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
Y--A--N--E--A--C--K--R--L--Q--A--H--G--R--R--K--P--Q--I--I--C--Y--P--E--T--G--H--Y--I--E--P--P--Y--F
ATGCTAATGAGGCCTGTAAACGCTTGCAGGCCCATGGGAGGAGAAAGCCCCAGATCATCTGTTACCCAGAGACAGGGCACTATATTGAGCCTCCTTACTT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--P--L--C--R--A--S--L--H--A--L--V--G--S--P--I--I--W--G--G--E--P--R--A--H--A--M--A--Q--V--D--A--W--K-
CCCCCTGTGTCGGGCTTCCCTGCATGCCTTGGTGGGCAGTCCTATTATCTGGGGAGGGGAGCCCAGGGCTCATGCCATGGCTCAGGTGGATGCTTGGAAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------->
-Q--L--Q--T--F--F--H--K--H--L--G--G--H--E--G--T--I--P--S--K--V--*-
CAACTCCAGACTTTCTTCCACAAACACTTGGGTGGCCACGAGGGGACAATCCCATCAAAAGTGTAA
                                                                  
------------------------------------------------------------------
------------------------------------------------------------------

Pig Consensus Sequence

>BGISUST0000884640
----------------------------------------------------------------------------------------------------
--------------CGCGACGAGAAGGGCGCGCTCTTCAGGGCCCACGCGCGCTACTGCGCCGACACCGACGGCCAGCTGGACCTGGCGCGCGCGCCCGC
GCTGGGCGGCAGCTTCGTGGGGCTCGAGCCCATGGGGCTCTTCTGGGCTCTGGAGCCCGAGAAGCCTTTGCTACGGCTGGTGAAGCGGGACGTGCAGACG
CCCTTCGCCGTGGAGCTGGAGGTGTTCGACGGCCACGAGCCCGAGGGCGGGCGGCTCCTGGGCCGGGCTGTGCACGAGCGCGACTTCCTGCCGCCCGGGG
TTCGGCGCGAGCCGGTGCGCGCGGGCCGGGTGCGCGCCACGCTTTTCCTGCCTCCA---CCTGGCCCCTTTCCTGGGATCGTGGACCTTTTTGGAGCTGG
AGGGGGCCTTCCAGAATACCGAGCCAGTCTGCTGGCTGGAAAGGGTTTTGCTGTGATGGCGCTGGCTTATCATAACTACGAAGACCTCCCCAAAGGCATA
GAGAATGTCCACCTGGAGTACTTTGAAGAAGCTGTGAACTACTTGCTTAGTCACCCTCAG----------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
------------------------------------------------------------------


>BGISUSP0000884640
--------------------------------------RDEKGALFRAHARYCADTDGQLDLARAPALGGSFVGLEPMGLFWALEPEKPLLRLVKRDVQT
PFAVELEVFDGHEPEGGRLLGRAVHERDFLPPGVRREPVRAGRVRATLFLPP-PGPFPGIVDLFGAGGGLPEYRASLLAGKGFAVMALAYHNYEDLPKGI
ENVHLEYFEEAVNYLLSHPQ--------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------