Sequences
EST Library Info
dbla1Unavailable
isp1M. Infraspinatus
plac1Unavailable
ret1Retina
tra1Trachea
Clusters
Oligos
SNPs

Gene ID ENSG00000174840 (click for geneview)
Transcript ID ENST00000311180(link to ensembl)
Symbol NP_808881.1
Localtion Chromosome:3:57517044:57522721:1 band: 3p14.3
Description 2'-phosphodiesterase
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--W--R--L--P--G--A--R--A--A--L--R--V--I--R--T--A--V--E--K--L--S--R--A--E--A--G--S--Q--T--A--A--G--
ATGTGGAGGCTCCCAGGCGCCCGCGCCGCGCTTCGGGTGATCCGGACGGCGGTGGAGAAGCTGAGCCGGGCTGAAGCGGGGAGCCAGACAGCGGCGGGAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
A--M--E--R--A--V--V--R--C--V--P--S--E--P--K--L--S--L--S--F--A--L--A--D--G--S--H--K--N--M--Q--R--D--Q
CGATGGAGCGCGCTGTAGTGCGCTGCGTACCTTCGGAACCCAAGCTGAGCCTGTCATTCGCTTTGGCTGATGGTAGCCACAAGAACATGCAGCGCGACCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--S--E--P--L--G--R--V--L--S--R--I--A--T--N--A--L--K--G--H--A--K--A--A--A--A--K--K--S--R--K--S--R--P-
GAGCGAGCCGCTGGGTCGAGTCCTCAGCCGCATCGCTACCAATGCCCTAAAGGGTCACGCTAAGGCGGCCGCCGCCAAGAAGAGCAGGAAGAGCCGGCCG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-N--A--S--G--G--A--A--C--S--G--P--G--P--E--P--A--V--F--C--E--P--V--V--K--L--Y--Y--R--E--E--A--V--A--
AATGCTAGCGGCGGTGCGGCCTGTTCAGGGCCGGGGCCTGAGCCGGCTGTGTTCTGCGAGCCCGTGGTGAAGCTGTACTACCGGGAAGAGGCAGTGGCTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
E--D--V--L--N--V--D--A--W--Q--D--G--A--V--L--Q--I--G--D--V--K--Y--K--V--E--R--N--P--P--A--F--T--E--L
AGGACGTGCTCAACGTGGATGCCTGGCAAGACGGCGCGGTGCTGCAGATCGGCGATGTTAAGTACAAGGTGGAGCGCAACCCGCCCGCCTTCACCGAACT
     ::::::::.:::::.::. ::::.:::::.:::::::::::::::::::::::.::.::::::::.::::::::::::::: ::.:::::::.::
-----GTGCTCAATGTGGACGCTNGGCAGGACGGTGCGGTGCTGCAGATCGGCGATGTCAAATACAAGGTAGAGCGCAACCCGCCCTCCCTCACCGAGCT
------V--L--N--V--D--A--X--Q--D--G--A--V--L--Q--I--G--D--V--K--Y--K--V--E--R--N--P--P--S--L--T--E--L

----------------------------------------------------------------------------------------------------
--Q--L--P--R--Y--I--M--A--G--F--P--V--C--P--K--L--S--L--E--F--G--D--P--A--S--S--L--F--R--W--Y--K--E-
GCAGTTGCCGCGCTACATCATGGCCGGGTTCCCTGTGTGCCCCAAACTCAGCCTCGAATTTGGGGATCCCGCCAGCTCCCTTTTCCGCTGGTATAAGGAA
::::::::::::::::::::::::::: ::::: :::::::::::.:::.:::::::::::::::::::::::.:::::::.:::::::::::.::::::
GCAGTTGCCGCGCTACATCATGGCCGGCTTCCCGGTGTGCCCCAAGCTCGGCCTCGAATTTGGGGATCCCGCCGGCTCCCTCTTCCGCTGGTACAAGGAA
--Q--L--P--R--Y--I--M--A--G--F--P--V--C--P--K--L--G--L--E--F--G--D--P--A--G--S--L--F--R--W--Y--K--E-

----------------------------------------------------------------------------------------------------
-A--K--P--G--A--A--E--P--E--V--G--V--P--S--S--L--S--P--S--S--P--S--S--S--W--T--E--T--D--V--E--E--R--
GCCAAGCCCGGAGCGGCGGAGCCCGAGGTCGGTGTCCCCTCGTCATTGTCTCCCTCCTCACCTTCTTCTTCTTGGACTGAGACTGATGTGGAGGAGCGTG
.::::.::.. :::::.::::::.:::: ::: : :: ::::::::::::::::::.:::::::::.::  ::::::.::::: :.::::.: :::::.:
ACCAAACCTACAGCGGTGGAGCCTGAGGGCGGAGGCCACTCGTCATTGTCTCCCTCTTCACCTTCTCCTGGTTGGACCGAGACGGGTGTGAACGAGCGCG
-T--K--P--T--A--V--E--P--E--G--G--G--H--S--S--L--S--P--S--S--P--S--P--G--W--T--E--T--G--V--N--E--R--

----------------------------------------------------------------------------------------------------
V--Y--T--P--S--N--A--D--I--G--L--R--L--K--L--H--C--T--P--G--D--G--Q--R--F--G--H--S--R--E--L--E--S--V
TCTACACCCCGTCCAATGCCGACATCGGGCTAAGGCTCAAGCTTCACTGCACCCCAGGCGATGGGCAGCGCTTTGGGCACAGCCGGGAGTTGGAAAGTGT
:::::::::::::::::::.:::::::::::: :::::::.:::::.::.:::::::::.::::::::::: :.::.:  :::::.::.:::::::::::
TCTACACCCCGTCCAATGCTGACATCGGGCTACGGCTCAAACTTCATTGTACCCCAGGCAATGGGCAGCGCATCGGACCAAGCCGAGAATTGGAAAGTGT
V--Y--T--P--S--N--A--D--I--G--L--R--L--K--L--H--C--T--P--G--N--G--Q--R--I--G--P--S--R--E--L--E--S--V

----------------------------------------------------------------------------------------------------
--C--V--V--E--A--G--P--G--T--C--T--F--D--H--R--H--L--Y--T--K--K--V--T--E--D--A--L--I--R--T--V--S--Y-
GTGTGTGGTAGAGGCTGGGCCTGGCACCTGCACTTTTGACCACCGGCATCTCTACACGAAGAAGGTGACTGAGGACGCTCTCATCCGCACTGTCTCTTAC
:::: .:::.:::::.:::::.::::: :::::.:::::::::::::::::::: : ::::::::::::::: :::::.::::::::::: :::::.:::
GTGTTCGGTGGAGGCCGGGCCCGGCACGTGCACCTTTGACCACCGGCATCTCTAGAAGAAGAAGGTGACTGACGACGCCCTCATCCGCACAGTCTCCTAC
--C--S--V--E--A--G--P--G--T--C--T--F--D--H--R--H--L--*--K--K--K--V--T--D--D--A--L--I--R--T--V--S--Y-

----------------------------------------------------------------------------------------------------
-N--I--L--A--D--T--Y--A--Q--T--E--F--S--R--T--V--L--Y--P--Y--C--A--P--Y--A--L--E--L--D--Y--R--Q--N--
AACATCCTGGCAGACACGTACGCGCAGACTGAGTTCTCGCGAACGGTTCTGTACCCATACTGTGCCCCCTACGCCCTGGAGCTCGACTACCGCCAGAACC
::: :.::::: :::::.::.:: ::::::::::::::.::.:::::.::::::::.:::::::::::.:::::::::::.:::::::::::::::::::
AACCTTCTGGCCGACACATATGCCCAGACTGAGTTCTCACGGACGGTCCTGTACCCGTACTGTGCCCCTTACGCCCTGGAACTCGACTACCGCCAGAACC
-N--L--L--A--D--T--Y--A--Q--T--E--F--S--R--T--V--L--Y--P--Y--C--A--P--Y--A--L--E--L--D--Y--R--Q--N--

----------------------------------------------------------------------------------------------------
L--I--Q--K--E--L--T--G--Y--N--A--D--V--I--C--L--Q--E--V--D--R--A--V--F--S--D--S--L--V--P--A--L--E--A
TTATCCAGAAGGAACTCACCGGCTACAACGCCGATGTCATCTGTTTGCAGGAGGTTGACCGCGCAGTGTTTTCTGACAGCTTGGTACCCGCCCTAGAGGC
:::::::.::::::::::: ::::::::::::::. ::::::::::::::::.::::::::::  :::::: : :::::::::::.:: ::::: :::::
TTATCCAAAAGGAACTCACGGGCTACAACGCCGACCTCATCTGTTTGCAGGAAGTTGACCGCGACGTGTTTACAGACAGCTTGGTGCCGGCCCTCGAGGC
L--I--Q--K--E--L--T--G--Y--N--A--D--L--I--C--L--Q--E--V--D--R--D--V--F--T--D--S--L--V--P--A--L--E--A

----------------------------------------------------------------------------------------------------
--F--G--L--E--G--V--F--R--I--K--Q--H--E--G--L--A--T--F--Y--R--K--S--K--F--S--L--L--S--Q--H--D--I--S-
CTTCGGGCTCGAGGGGGTGTTTCGAATCAAGCAGCACGAAGGCCTGGCCACTTTCTACCGAAAGTCTAAGTTCAGCCTTCTTAGCCAGCATGACATTTCA
:::.::::: ::::: ::::::::::::::::::::.:::::::: ::.:::::.:::::::::::.:::::::::::.:::::::::::::::::: : 
CTTTGGGCTGGAGGGCGTGTTTCGAATCAAGCAGCATGAAGGCCTCGCTACTTTTTACCGAAAGTCCAAGTTCAGCCTCCTTAGCCAGCATGACATTGCT
--F--G--L--E--G--V--F--R--I--K--Q--H--E--G--L--A--T--F--Y--R--K--S--K--F--S--L--L--S--Q--H--D--I--A-

----------------------------------------------------------------------------------------------------
-F--Y--E--A--L--E--S--D--P--L--H--K--E--L--L--E--K--L--V--L--Y--P--S--A--Q--E--K--V--L--Q--R--S--S--
TTCTACGAAGCCCTCGAGTCCGACCCACTTCACAAAGAACTGCTGGAGAAACTAGTTTTGTACCCATCAGCGCAGGAGAAGGTGCTCCAGAGATCTTCTG
:::.:.::.:::::  :::::::::::::::::::::::::::::::::::::.:::::.:::::: ::::::::::.::::::::.:::::::::::::
TTCCATGAGGCCCTGCAGTCCGACCCACTTCACAAAGAACTGCTGGAGAAACTGGTTTTATACCCAGCAGCGCAGGAAAAGGTGCTTCAGAGATCTTCTG
-F--H--E--A--L--Q--S--D--P--L--H--K--E--L--L--E--K--L--V--L--Y--P--A--A--Q--E--K--V--L--Q--R--S--S--

-------><-----------------------------------------------------------------------------><------------
V--L--Q--V--S--V--L--Q--S--T--K--D--S--S--K--R--I--C--V--A--N--T--H--L--Y--W--H--P--K--G--G--Y--I--R
TTCTTCAGGTTTCAGTTCTTCAGTCTACAAAGGACTCTTCTAAAAGGATATGTGTTGCTAATACCCATCTTTACTGGCATCCTAAAGGTGGGTATATTCG
:.::::::::::: :::::::::::::::::::::::.:::::::. :::::::::::::::::::::::.:::::::: ::.:::   :::::.:::::
TCCTTCAGGTTTCTGTTCTTCAGTCTACAAAGGACTCCTCTAAAAACATATGTGTTGCTAATACCCATCTCTACTGGCAGCCCAAA---GGGTACATTCG
V--L--Q--V--S--V--L--Q--S--T--K--D--S--S--K--N--I--C--V--A--N--T--H--L--Y--W--Q--P--K-----G--Y--I--R

----------------------------------------------------------------------------------------------------
--L--I--Q--M--A--V--A--L--A--H--I--R--H--V--S--C--D--L--Y--P--G--I--P--V--I--F--C--G--D--F--N--S--T-
CCTCATTCAAATGGCAGTAGCCTTGGCTCACATAAGACATGTTTCATGTGATCTGTATCCTGGCATACCAGTTATATTTTGTGGGGACTTTAATAGTACA
.:::::::::::::::::::::::::::::::: ::::::::.:: ::::: .::::::::::::::::::::.::::::::::::::::::::::::: 
TCTCATTCAAATGGCAGTAGCCTTGGCTCACATTAGACATGTCTCTTGTGAGTTGTATCCTGGCATACCAGTTGTATTTTGTGGGGACTTTAATAGTACC
--L--I--Q--M--A--V--A--L--A--H--I--R--H--V--S--C--E--L--Y--P--G--I--P--V--V--F--C--G--D--F--N--S--T-

----------------------------------------------------------------------------------------------------
-P--S--T--G--M--Y--H--F--V--I--N--G--S--I--P--E--D--H--E--D--W--A--S--N--G--E--E--E--R--C--N--M--S--
CCATCAACAGGAATGTATCATTTTGTCATCAATGGCAGCATTCCAGAGGATCATGAAGACTGGGCTTCCAATGGGGAGGAGGAAAGATGCAATATGTCTC
::::::::::::::::::::.::::::::::::::::::::::::::::::::::::::::::::::: ::::::::.::.::: :::::::.:::::::
CCATCAACAGGAATGTATCACTTTGTCATCAATGGCAGCATTCCAGAGGATCATGAAGACTGGGCTTCAAATGGGGAAGAAGAACGATGCAACATGTCTC
-P--S--T--G--M--Y--H--F--V--I--N--G--S--I--P--E--D--H--E--D--W--A--S--N--G--E--E--E--R--C--N--M--S--

----------------------------------------------------------------------------------------------------
L--T--H--F--F--K--L--K--S--A--C--G--E--P--A--Y--T--N--Y--V--G--G--F--H--G--C--L--D--Y--I--F--I--D--L
TTACACATTTCTTCAAGCTGAAAAGTGCTTGTGGTGAACCTGCTTACACAAATTATGTTGGTGGCTTTCATGGATGTCTAGATTACATTTTCATTGACTT
:::: :::::::::::.:::::::::::::::::::::::::::::.:::::::::::::::::.::::::::::::::.::::::::::::::::::::
TTACCCATTTCTTCAAACTGAAAAGTGCTTGTGGTGAACCTGCTTATACAAATTATGTTGGTGGTTTTCATGGATGTCTGGATTACATTTTCATTGACTT
L--T--H--F--F--K--L--K--S--A--C--G--E--P--A--Y--T--N--Y--V--G--G--F--H--G--C--L--D--Y--I--F--I--D--L

----------------------------------------------------------------------------------------------------
--N--A--L--E--V--E--Q--V--I--P--L--P--S--H--E--E--V--T--T--H--Q--A--L--P--S--V--S--H--P--S--D--H--I-
AAATGCTTTAGAGGTTGAACAGGTGATTCCATTACCTAGTCATGAAGAAGTTACCACCCACCAGGCCTTACCTAGTGTTTCCCATCCCTCTGATCACATA
:::..::::::::::::::::::::::::::::::: ::::::::::::::::::::::::::::::::::::::::::::::::::.::::::::.:::
AAACACTTTAGAGGTTGAACAGGTGATTCCATTACCAAGTCATGAAGAAGTTACCACCCACCAGGCCTTACCTAGTGTTTCCCATCCTTCTGATCATATA
--N--T--L--E--V--E--Q--V--I--P--L--P--S--H--E--E--V--T--T--H--Q--A--L--P--S--V--S--H--P--S--D--H--I-

----------------------------->
-A--L--V--C--D--L--K--W--K--*-
GCACTTGTATGTGATTTAAAATGGAAATAG
::::::::.::.::.:::::::::::::::
GCACTTGTGTGCGACTTAAAATGGAAATAG
-A--L--V--C--D--L--K--W--K--*-

Pig Consensus Sequence

>BGISUST0000887646
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-----GTGCTCAATGTGGACGCTNGGCAGGACGGTGCGGTGCTGCAGATCGGCGATGTCAAATACAAGGTAGAGCGCAACCCGCCCTCCCTCACCGAGCT
GCAGTTGCCGCGCTACATCATGGCCGGCTTCCCGGTGTGCCCCAAGCTCGGCCTCGAATTTGGGGATCCCGCCGGCTCCCTCTTCCGCTGGTACAAGGAA
ACCAAACCTACAGCGGTGGAGCCTGAGGGCGGAGGCCACTCGTCATTGTCTCCCTCTTCACCTTCTCCTGGTTGGACCGAGACGGGTGTGAACGAGCGCG
TCTACACCCCGTCCAATGCTGACATCGGGCTACGGCTCAAACTTCATTGTACCCCAGGCAATGGGCAGCGCATCGGACCAAGCCGAGAATTGGAAAGTGT
GTGTTCGGTGGAGGCCGGGCCCGGCACGTGCACCTTTGACCACCGGCATCTCTAGAAGAAGAAGGTGACTGACGACGCCCTCATCCGCACAGTCTCCTAC
AACCTTCTGGCCGACACATATGCCCAGACTGAGTTCTCACGGACGGTCCTGTACCCGTACTGTGCCCCTTACGCCCTGGAACTCGACTACCGCCAGAACC
TTATCCAAAAGGAACTCACGGGCTACAACGCCGACCTCATCTGTTTGCAGGAAGTTGACCGCGACGTGTTTACAGACAGCTTGGTGCCGGCCCTCGAGGC
CTTTGGGCTGGAGGGCGTGTTTCGAATCAAGCAGCATGAAGGCCTCGCTACTTTTTACCGAAAGTCCAAGTTCAGCCTCCTTAGCCAGCATGACATTGCT
TTCCATGAGGCCCTGCAGTCCGACCCACTTCACAAAGAACTGCTGGAGAAACTGGTTTTATACCCAGCAGCGCAGGAAAAGGTGCTTCAGAGATCTTCTG
TCCTTCAGGTTTCTGTTCTTCAGTCTACAAAGGACTCCTCTAAAAACATATGTGTTGCTAATACCCATCTCTACTGGCAGCCCAAA---GGGTACATTCG
TCTCATTCAAATGGCAGTAGCCTTGGCTCACATTAGACATGTCTCTTGTGAGTTGTATCCTGGCATACCAGTTGTATTTTGTGGGGACTTTAATAGTACC
CCATCAACAGGAATGTATCACTTTGTCATCAATGGCAGCATTCCAGAGGATCATGAAGACTGGGCTTCAAATGGGGAAGAAGAACGATGCAACATGTCTC
TTACCCATTTCTTCAAACTGAAAAGTGCTTGTGGTGAACCTGCTTATACAAATTATGTTGGTGGTTTTCATGGATGTCTGGATTACATTTTCATTGACTT
AAACACTTTAGAGGTTGAACAGGTGATTCCATTACCAAGTCATGAAGAAGTTACCACCCACCAGGCCTTACCTAGTGTTTCCCATCCTTCTGATCATATA
GCACTTGTGTGCGACTTAAAATGGAAATAG


>BGISUSP0000887646
----------------------------------------------------------------------------------------------------
-----------------------------------VLNVDA-QDGAVLQIGDVKYKVERNPPSLTELQLPRYIMAGFPVCPKLGLEFGDPAGSLFRWYKE
TKPTAVEPEGGGHSSLSPSSPSPGWTETGVNERVYTPSNADIGLRLKLHCTPGNGQRIGPSRELESVCSVEAGPGTCTFDHRHL*KKKVTDDALIRTVSY
NLLADTYAQTEFSRTVLYPYCAPYALELDYRQNLIQKELTGYNADLICLQEVDRDVFTDSLVPALEAFGLEGVFRIKQHEGLATFYRKSKFSLLSQHDIA
FHEALQSDPLHKELLEKLVLYPAAQEKVLQRSSVLQVSVLQSTKDSSKNICVANTHLYWQPK-GYIRLIQMAVALAHIRHVSCELYPGIPVVFCGDFNST
PSTGMYHFVINGSIPEDHEDWASNGEEERCNMSLTHFFKLKSACGEPAYTNYVGGFHGCLDYIFIDLNTLEVEQVIPLPSHEEVTTHQALPSVSHPSDHI
ALVCDLKWK*