Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000174844 (click for geneview)
Transcript ID ENST00000311202(link to ensembl)
Symbol NP_940966.1
Localtion Chromosome:3:57458771:57505108:-1 band: 3p14.3
Description FLJ44290 protein
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--S--D--A--N--K--A--A--I--A--A--E--K--E--A--L--N--L--K--L--P--P--I--V--H--L--P--E--N--I--G--V--D--
ATGTCAGATGCAAACAAAGCTGCCATTGCAGCAGAAAAGGAAGCTCTGAACTTGAAGTTACCCCCCATTGTCCATCTCCCAGAAAACATAGGCGTTGATA
::::::::: ::::.::::::::::::::::::::::::::.::::::::::::::::::::.::::::::::. :.::: :::.:::::::.:::::.:
ATGTCAGATCCAAATAAAGCTGCCATTGCAGCAGAAAAGGAGGCTCTGAACTTGAAGTTACCTCCCATTGTCCGACCCCCTGAAGACATAGGTGTTGACA
-M--S--D--P--N--K--A--A--I--A--A--E--K--E--A--L--N--L--K--L--P--P--I--V--R--P--P--E--D--I--G--V--D--

---------------------------------------------------------------------><-----------------------------
T--P--T--Q--S--K--L--L--K--Y--R--R--S--K--E--Q--Q--Q--K--I--N--Q--L--V--I--D--G--A--K--R--N--L--D--R
CACCAACACAAAGTAAGCTGCTAAAATACAGAAGATCCAAGGAGCAGCAGCAGAAAATTAATCAGTTAGTAATTGATGGAGCCAAAAGAAATTTAGACAG
:::::::.::::::::::::::.:. :::::::::::::::::: ::::: ::: :::::::::::::                                
CACCAACGCAAAGTAAGCTGCTGAGTTACAGAAGATCCAAGGAGGAGCAGAAGACAATTAATCAGTTA--------------------------------
T--P--T--Q--S--K--L--L--S--Y--R--R--S--K--E--E--Q--K--T--I--N--Q--L---------------------------------

---------------------------------------------------><-------------------------><--------------------
--T--L--G--K--R--T--P--L--L--P--P--P--D--Y--P--Q--T--M--T--S--E--M--K--K--K--G--F--N--Y--I--Y--M--K-
AACACTGGGTAAAAGAACACCTCTATTACCACCACCTGATTATCCTCAAACTATGACCAGTGAAATGAAAAAAAAAGGATTCAACTATATTTATATGAAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-Q--C--V--E--S--S--P--L--V--P--I--Q--Q--E--W--L--D--H--M--L--R--L--I--P--E--S--L--K--E--G--K--E--R--
CAATGTGTAGAAAGTAGTCCTTTAGTACCTATTCAGCAGGAATGGCTGGATCACATGTTAAGGCTGATACCTGAGTCTTTAAAGGAAGGGAAAGAAAGAG
                                    ::::::::::::::::::::::::: :.::::::::::::::::::::::::::::::::::::
------------------------------------CAGGAATGGCTGGATCACATGTTAATGTTGATACCTGAGTCTTTAAAGGAAGGGAAAGAAAGAG
-------------------------------------Q--E--W--L--D--H--M--L--M--L--I--P--E--S--L--K--E--G--K--E--R--

--------------------------------------------------------------------><------------------------------
E--E--L--L--E--S--L--I--N--E--V--S--S--D--F--E--N--S--M--K--R--Y--L--V--Q--S--V--L--V--K--P--P--V--K
AAGAACTTCTTGAAAGTCTCATAAATGAGGTGTCAAGTGACTTTGAAAACAGCATGAAGAGATATTTGGTGCAGAGCGTTCTTGTGAAACCACCAGTTAA
:::::::. :: ::::::::::::.:::::::::::::::.:::::::: ::::::::::::::::::                                
AAGAACTCGTTCAAAGTCTCATAAGTGAGGTGTCAAGTGATTTTGAAAAAAGCATGAAGAGATATTTG--------------------------------
E--E--L--V--Q--S--L--I--S--E--V--S--S--D--F--E--K--S--M--K--R--Y--L---------------------------------

-----------------------------------------><---------------------------------------------------------
--S--L--E--D--E--G--G--P--L--P--E--S--P--V--G--L--D--Y--S--N--P--W--H--S--S--Y--V--Q--A--R--N--Q--I-
ATCGCTTGAAGATGAAGGAGGTCCTTTACCTGAATCTCCTGTAGGCCTAGATTATTCTAATCCTTGGCATTCTAGCTATGTGCAGGCAAGAAATCAAATA
                                           :::::.::::::::::: :::::::::::::.:::: ::::::::::::::::::::
-------------------------------------------GGCCTGGATTATTCTAAGCCTTGGCATTCTAACTATCTGCAGGCAAGAAATCAAATA
--------------------------------------------G--L--D--Y--S--K--P--W--H--S--N--Y--L--Q--A--R--N--Q--I-

----------------------------------------------------------------------------------------------------
-F--S--N--L--H--I--I--H--P--T--M--K--M--L--L--D--L--G--Y--T--T--F--A--D--T--V--L--L--D--F--T--G--I--
TTCTCTAATTTGCACATTATTCATCCAACTATGAAAATGTTACTGGACCTTGGTTATACAACATTTGCTGATACAGTTTTGTTGGACTTCACAGGAATTA
::  :.::::::::::::.::::::::::::::::::::.:::::::::::::::::::.::::::::..:::::.::::: :.::::: :: :::::: 
TTAGCCAATTTGCACATTGTTCATCCAACTATGAAAATGCTACTGGACCTTGGTTATACGACATTTGCCAATACAATTTTGATAGACTTAACTGGAATT-
-L--A--N--L--H--I--V--H--P--T--M--K--M--L--L--D--L--G--Y--T--T--F--A--N--T--I--L--I--D--L--T--G--I--

><--------------------------------------------------------------------------------------------------
R--A--K--G--P--I--D--C--E--S--L--K--T--D--L--S--I--Q--T--R--N--A--E--E--K--I--M--N--T--W--Y--P--K--V
GAGCTAAAGGTCCAATTGACTGTGAATCACTGAAAACTGATCTATCAATACAAACTAGAAACGCAGAAGAGAAGATAATGAATACATGGTATCCAAAGGT
  . ::::::.::::::::.::::::::: :::::: ::::.:::::::::::.::::::: ::::::::::::::::::::.:::::::::::::::::
--AGTAAAGGCCCAATTGATTGTGAATCAATGAAAAATGATTTATCAATACAAGCTAGAAAGGCAGAAGAGAAGATAATGAACACATGGTATCCAAAGGT
---S--K--G--P--I--D--C--E--S--M--K--N--D--L--S--I--Q--A--R--K--A--E--E--K--I--M--N--T--W--Y--P--K--V

------------------------------------------------------------------------------------------------><--
--I--N--L--F--T--K--K--E--A--L--E--G--V--K--P--E--K--L--D--A--F--Y--S--C--V--S--T--L--M--S--N--Q--L-
TATAAATCTCTTTACCAAGAAGGAGGCACTAGAAGGTGTTAAACCTGAAAAATTGGATGCATTTTATAGCTGTGTTTCCACACTTATGTCAAATCAGCTA
:::::.::::::::::::::::::::: ::::::::..::::::::::.: :::::::::::::::::.:::::::::.:::::::: :::::::::   
TATAAGTCTCTTTACCAAGAAGGAGGCCCTAGAAGGCATTAAACCTGAGACATTGGATGCATTTTATAACTGTGTTTCTACACTTATTTCAAATCAG---
--I--S--L--F--T--K--K--E--A--L--E--G--I--K--P--E--T--L--D--A--F--Y--N--C--V--S--T--L--I--S--N--Q----

----------------------------------------------------------------------------------------------------
-K--D--L--L--R--R--T--V--E--G--F--V--K--L--F--D--P--K--D--Q--Q--R--L--P--I--F--K--I--E--L--T--F--D--
AAGGATCTATTAAGGAGAACTGTAGAAGGATTTGTAAAACTCTTTGACCCAAAAGATCAACAAAGGCTGCCAATATTTAAGATAGAATTGACATTTGATG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------------------------------------------------------------------><-------------
D--D--K--M--E--F--Y--P--T--F--Q--D--L--E--D--N--V--L--S--L--V--E--R--I--A--E--A--L--Q--N--V--Q--T--I
ACGACAAAATGGAATTTTATCCTACCTTTCAAGATTTGGAAGATAATGTCTTGAGTTTGGTGGAACGAATAGCCGAAGCTCTGCAGAATGTCCAAACAAT
                                                                                      ::::::::.:::.:
--------------------------------------------------------------------------------------AATGTCCAGACAGT
---------------------------------------------------------------------------------------N--V--Q--T--V

----------------------------------------------------------------------------------------------------
--P--S--W--L--S--G--T--S--T--P--V--N--L--D--T--E--L--P--E--H--V--L--H--W--A--V--D--T--L--K--A--A--V-
CCCCTCTTGGCTATCAGGAACTTCAACACCAGTAAATCTTGACACAGAACTTCCTGAACACGTGTTACACTGGGCTGTTGATACACTGAAGGCAGCAGTA
 :::::.::::::::::::::::::::: : ::.::: ::::::::::::::::::::::::::::::: :::::: ::.::::.:::::::..::::::
ACCCTCCTGGCTATCAGGAACTTCAACAACTGTGAATATTGACACAGAACTTCCTGAACACGTGTTACAATGGGCTCTTAATACGCTGAAGGTGGCAGTA
--P--S--W--L--S--G--T--S--T--T--V--N--I--D--T--E--L--P--E--H--V--L--Q--W--A--L--N--T--L--K--V--A--V-

------------------------------------------><--------------------------------------------------------
-H--R--N--L--E--G--A--R--K--H--Y--E--T--Y--V--E--K--Y--N--W--L--L--D--G--T--A--V--E--N--I--E--T--F--
CATCGGAACTTAGAAGGTGCAAGAAAGCATTATGAGACATATGTTGAAAAATATAATTGGCTCCTTGATGGGACTGCAGTTGAGAATATAGAGACTTTTC
::::::::::::::.:::::::::::.:::::::::::::::   ::::::::. ::::::::::::::::::::::::::::: : ::::    :::::
CATCGGAACTTAGAGGGTGCAAGAAAACATTATGAGACATAT---GAAAAATACCATTGGCTCCTTGATGGGACTGCAGTTGAGCAAATAGCTTGTTTTC
-H--R--N--L--E--G--A--R--K--H--Y--E--T--Y-----E--K--Y--H--W--L--L--D--G--T--A--V--E--Q--I--A--C--F--

----------------------------------><------------------------------------->
Q--T--E--D--H--T--F--D--E--Y--T--E--E--L--D--C--W--V--V--W--E--V--Y--F--*-
AGACAGAAGATCATACTTTTGATGAATATACAGAGGAGCTGGATTGCTGGGTGGTATGGGAAGTGTATTTTTAA
::..::::::::::::::::::::::::.::::::                                       
AGGTAGAAGATCATACTTTTGATGAATACACAGAG---------------------------------------
Q--V--E--D--H--T--F--D--E--Y--T--E----------------------------------------

Pig Consensus Sequence

>BGISUST0000888482
ATGTCAGATCCAAATAAAGCTGCCATTGCAGCAGAAAAGGAGGCTCTGAACTTGAAGTTACCTCCCATTGTCCGACCCCCTGAAGACATAGGTGTTGACA
CACCAACGCAAAGTAAGCTGCTGAGTTACAGAAGATCCAAGGAGGAGCAGAAGACAATTAATCAGTTA--------------------------------
----------------------------------------------------------------------------------------------------
------------------------------------CAGGAATGGCTGGATCACATGTTAATGTTGATACCTGAGTCTTTAAAGGAAGGGAAAGAAAGAG
AAGAACTCGTTCAAAGTCTCATAAGTGAGGTGTCAAGTGATTTTGAAAAAAGCATGAAGAGATATTTG--------------------------------
-------------------------------------------GGCCTGGATTATTCTAAGCCTTGGCATTCTAACTATCTGCAGGCAAGAAATCAAATA
TTAGCCAATTTGCACATTGTTCATCCAACTATGAAAATGCTACTGGACCTTGGTTATACGACATTTGCCAATACAATTTTGATAGACTTAACTGGAATT-
--AGTAAAGGCCCAATTGATTGTGAATCAATGAAAAATGATTTATCAATACAAGCTAGAAAGGCAGAAGAGAAGATAATGAACACATGGTATCCAAAGGT
TATAAGTCTCTTTACCAAGAAGGAGGCCCTAGAAGGCATTAAACCTGAGACATTGGATGCATTTTATAACTGTGTTTCTACACTTATTTCAAATCAG---
----------------------------------------------------------------------------------------------------
--------------------------------------------------------------------------------------AATGTCCAGACAGT
ACCCTCCTGGCTATCAGGAACTTCAACAACTGTGAATATTGACACAGAACTTCCTGAACACGTGTTACAATGGGCTCTTAATACGCTGAAGGTGGCAGTA
CATCGGAACTTAGAGGGTGCAAGAAAACATTATGAGACATAT---GAAAAATACCATTGGCTCCTTGATGGGACTGCAGTTGAGCAAATAGCTTGTTTTC
AGGTAGAAGATCATACTTTTGATGAATACACAGAG---------------------------------------


>BGISUSP0000888482
MSDPNKAAIAAEKEALNLKLPPIVRPPEDIGVDTPTQSKLLSYRRSKEEQKTINQL--------------------------------------------
------------QEWLDHMLMLIPESLKEGKEREELVQSLISEVSSDFEKSMKRYL-------------------------GLDYSKPWHSNYLQARNQI
LANLHIVHPTMKMLLDLGYTTFANTILIDLTGI-SKGPIDCESMKNDLSIQARKAEEKIMNTWYPKVISLFTKKEALEGIKPETLDAFYNCVSTLISNQ-
--------------------------------------------------------------NVQTVPSWLSGTSTTVNIDTELPEHVLQWALNTLKVAV
HRNLEGARKHYETY-EKYHWLLDGTAVEQIACFQVEDHTFDEYTE-------------