Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000174083 (click for geneview)
Transcript ID ENST00000311434(link to ensembl)
Symbol NP_001010855.1
Localtion Chromosome:17:8646766:8711719:-1 band: 17p13.1
Description chromosome 17 open reading frame 38
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-----------><----------------------------------------------------------------------------------><--
-M--E--S--S--D--V--E--L--D--L--Q--R--S--V--Q--A--V--L--R--E--L--S--T--Q--A--P--A--L--Q--S--N--Q--G--
ATGGAGAGCTCAGATGTGGAGCTGGACCTCCAGAGGAGCGTGCAGGCTGTGCTCCGGGAGCTCAGCACCCAGGCCCCTGCCCTGCAGAGCAACCAAGGCA
               :::::::::::.:: ::: :::::::.:::::::::::: ::::::::::..::::::::::.::::::::::::::::::   :
---------------GTGGAGCTGGATCTGCAGCGGAGCGTACAGGCTGTGCTCAGGGAGCTCAGTGCCCAGGCCCCCGCCCTGCAGAGCAACCAA---A
----------------V--E--L--D--L--Q--R--S--V--Q--A--V--L--R--E--L--S--A--Q--A--P--A--L--Q--S--N--Q-----

----------------------------------------------------------------------------------------><----------
M--W--R--W--S--L--H--K--K--V--E--R--D--P--G--K--S--P--V--L--V--R--I--L--L--R--E--L--E--K--A--E--S--Q
TGTGGAGGTGGTCCCTGCACAAGAAGGTCGAGCGAGATCCCGGTAAGAGCCCAGTGCTGGTCCGCATTCTTCTCAGAGAACTGGAGAAGGCGGAAAGCCA
:::: ::::::::::::::::::::::: ::::::::::::::::::::.::.:.::::::::::::::: ::::::::::::::::::::.:::::  :
TGTGCAGGTGGTCCCTGCACAAGAAGGTGGAGCGAGATCCCGGTAAGAGTCCGGCGCTGGTCCGCATTCTGCTCAGAGAACTGGAGAAGGCAGAAAGGGA
M--C--R--W--S--L--H--K--K--V--E--R--D--P--G--K--S--P--A--L--V--R--I--L--L--R--E--L--E--K--A--E--R--E

---------------------------------------------------------><-----------------------------------------
--D--L--R--H--V--I--I--P--L--L--H--T--V--M--Y--V--L--T--K--A--T--G--I--T--E--E--L--Y--Q--R--I--Y--A-
GGACCTCCGGCATGTCATCATTCCCTTGCTGCACACTGTAATGTACGTGCTCACCAAGGCCACAGGAATCACAGAAGAGCTCTACCAGAGAATCTATGCC
:::: .::::::::::::: :::::.::::::::::  : ::::::::::::::.:::                                          
GGACACCCGGCATGTCATCCTTCCCCTGCTGCACACGCTCATGTACGTGCTCACTAAG------------------------------------------
--D--T--R--H--V--I--L--P--L--L--H--T--L--M--Y--V--L--T--K-------------------------------------------

------------------------------------------------------------------------------------------><--------
-F--C--T--R--L--L--T--L--P--T--P--Y--C--T--V--A--L--D--C--A--I--R--L--K--T--E--M--A--V--P--G--T--L--
TTTTGCACAAGGTTACTGACCCTGCCCACCCCCTACTGCACAGTCGCCTTGGACTGCGCGATAAGGCTGAAAACGGAGATGGCTGTCCCAGGGACACTGT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------------------------------------------------------><--------------------------------------
Y--Q--R--M--V--I--A--E--Q--N--L--T--N--E--L--Y--P--Y--Q--E--R--V--F--L--F--V--D--P--E--L--V--S--A--S
ACCAAAGGATGGTCATTGCCGAACAGAACTTGACGAATGAGCTGTATCCCTACCAGGAGAGAGTGTTCCTCTTCGTGGATCCTGAGCTGGTGTCTGCGTC
                                                              :: :::::::::::::::::::::::::::::: : ::
--------------------------------------------------------------GTCTTCCTCTTCGTGGATCCTGAGCTGGTGTCTCCTTC
---------------------------------------------------------------V--F--L--F--V--D--P--E--L--V--S--P--S

----------------------------------------------------------------------------------------------------
--V--C--S--A--L--L--L--E--I--E--A--A--Q--A--Q--Q--T--P--E--T--C--M--R--H--V--V--S--H--A--L--Q--A--A-
TGTGTGCAGTGCTCTGCTACTGGAGATCGAGGCGGCCCAGGCGCAGCAGACACCAGAGACCTGCATGCGCCACGTGGTCTCCCACGCCCTGCAGGCGGCT
.:::::::::::.:::::.:::::: :  ::::::::::.: :::::::::.:: :::.:::::::::::::::::::::::::::: ::::::::::: 
CGTGTGCAGTGCCCTGCTGCTGGAGCTGCAGGCGGCCCAAGAGCAGCAGACGCCCGAGGCCTGCATGCGCCACGTGGTCTCCCACGCGCTGCAGGCGGCG
--V--C--S--A--L--L--L--E--L--Q--A--A--Q--E--Q--Q--T--P--E--A--C--M--R--H--V--V--S--H--A--L--Q--A--A-

--------------------------------------------><------------------------------------------------------
-L--G--E--A--C--H--A--G--A--L--H--R--K--L--Q--A--S--P--R--R--T--L--E--H--Y--F--H--A--V--V--A--A--L--
CTGGGGGAGGCCTGTCACGCAGGCGCTCTGCACAGGAAGCTGCAGGCCAGCCCTCGCCGCACCCTGGAGCACTATTTCCACGCCGTGGTGGCCGCCTTGG
::::::::::::::.:: :::::::: ::::: :.::.:::::::                                                       
CTGGGGGAGGCCTGCCAGGCAGGCGCACTGCAAAAGAGGCTGCAG-------------------------------------------------------
-L--G--E--A--C--Q--A--G--A--L--Q--K--R--L--Q--------------------------------------------------------

----------------------------------------------------------------------------------------------------
E--Q--M--A--S--E--A--S--P--S--R--E--G--H--V--E--R--L--E--E--I--Y--C--S--L--L--G--P--A--A--G--R--C--G
AGCAGATGGCCAGCGAGGCCAGCCCGAGCCGGGAGGGACACGTAGAGAGGCTGGAGGAGATTTACTGCTCGCTGCTGGGTCCCGCGGCGGGGCGCTGCGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-><-------------------------------------------------------------------------------------><----------
--G--D--L--V--Q--E--R--P--P--S--I--P--L--P--S--P--Y--I--T--F--H--L--W--T--G--E--E--Q--L--W--K--E--L-
TGGTGACCTTGTCCAAGAGCGGCCACCAAGCATTCCCCTGCCCAGCCCCTACATCACCTTCCACTTGTGGACCGGTGAGGAGCAGCTCTGGAAGGAACTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-V--L--F--L--R--P--R--S--Q--L--R--L--S--A--D--L--E--V--L--D--L--Q--G--L--R--P--D--R--E--L--A--R--V--
GTGCTCTTCCTCCGCCCAAGATCCCAGCTGCGCCTCAGTGCTGACTTGGAGGTCTTGGATCTGCAGGGCCTCCGGCCGGACCGGGAGTTGGCCCGGGTTT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
S--V--L--S--T--D--S--G--I--E--R--D--L--P--T--G--A--D--E--L--P--A--P--G--S--P--E--M--E--R--A--G--L--Q
CTGTGCTGTCCACTGACAGCGGCATTGAGCGGGACCTTCCCACGGGGGCTGATGAGCTGCCTGCACCCGGCAGCCCTGAGATGGAGCGAGCCGGGCTGCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--R--K--G--G--I--K--K--R--A--W--P--L--D--F--L--M--P--G--S--W--D--G--P--P--G--L--H--R--R--T--G--R--P-
GCGCAAAGGGGGCATCAAGAAGCGTGCATGGCCCCTGGACTTCTTGATGCCTGGCAGCTGGGACGGGCCCCCAGGGCTGCACCGGAGGACAGGCCGGCCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-S--G--D--G--E--M--L--P--G--V--S--R--L--H--T--A--R--V--L--V--L--G--D--D--R--M--L--G--R--L--A--Q--A--
AGTGGGGATGGGGAAATGCTGCCCGGCGTGTCCCGGCTGCACACAGCCCGGGTACTTGTGCTCGGAGATGACAGGATGCTGGGGCGCCTGGCCCAGGCCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------><-----------------------------------------------------------------------------><-------
Y--H--R--L--R--K--R--E--T--Q--K--F--C--L--T--P--R--L--S--L--Q--L--Y--Y--I--P--V--L--A--P--E--K--P--A
ACCACAGACTCAGGAAACGGGAGACCCAGAAGTTCTGCCTCACTCCCAGACTCAGCCTGCAGCTCTACTACATCCCCGTGCTGGCGCCTGAGAAGCCTGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--A--S--R--Q--P--E--L--G--E--L--A--T--F--L--G--R--V--D--P--W--Y--Q--S--N--V--N--T--L--C--P--A--I--H-
AGCATCCAGGCAGCCGGAGCTGGGAGAGCTGGCTACGTTCCTGGGCCGCGTAGACCCGTGGTACCAGAGCAACGTCAACACGCTGTGCCCCGCCATCCAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------><------------------------------------------------------------------------------------
-K--L--A--E--M--P--P--S--L--D--T--S--R--T--V--D--P--F--I--L--D--V--I--T--Y--Y--I--R--M--G--T--Q--P--
AAGCTGGCTGAGATGCCTCCTTCCCTGGACACATCCCGGACTGTGGACCCCTTCATCCTAGACGTCATCACCTACTACATCCGCATGGGCACCCAACCCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------><-------------------------------------------------------------------------
I--Y--F--Q--I--Y--T--V--K--I--F--F--S--D--L--S--Q--D--P--T--E--D--I--F--L--I--E--L--K--V--K--I--Q--D
TCTATTTCCAGATCTACACAGTCAAGATCTTTTTCAGTGACCTGAGCCAAGACCCTACTGAGGACATTTTCCTCATTGAACTGAAGGTGAAGATCCAAGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------><---------------------------------------------------------------------><-----------
--S--K--F--P--K--D--G--F--S--P--R--R--R--G--V--A--E--G--P--G--A--E--L--S--L--C--Y--Q--K--A--L--L--S-
TTCTAAATTCCCCAAAGATGGCTTTTCACCCAGGAGGAGAGGCGTGGCTGAGGGCCCAGGGGCAGAGCTCTCCCTATGCTACCAGAAGGCCTTGCTTAGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----------------------><--------------------------------------------------><-----------------------
-H--R--P--R--E--V--T--V--L--R--A--T--G--L--I--L--K--A--I--P--A--S--D--T--E--V--S--G--S--S--H--C--P--
CACCGGCCCCGAGAGGTCACCGTTCTGCGGGCCACTGGGCTGATCCTGAAGGCCATTCCAGCCAGCGACACAGAAGTTTCAGGGTCTAGCCATTGCCCCC
                                                                              ::::::.:.: :::.::  :::
------------------------------------------------------------------------------TCAGGGCCCACCCACTGGACCC
-------------------------------------------------------------------------------S--G--P--T--H--W--T--

-------------------------------------------------------------------------------------------><-------
L--P--A--A--P--V--T--D--H--T--C--L--N--V--N--V--T--E--V--V--K--S--S--N--L--A--G--K--S--F--S--T--V--T
TGCCTGCTGCTCCTGTCACAGACCACACATGTCTGAATGTCAACGTGACAGAGGTTGTCAAGTCCTCCAACTTGGCGGGAAAGTCCTTCTCTACAGTGAC
.. ::::::::::. : ::::::::::..::.::::::::::::::.::::::::..:::::  :::::::::::: ::::.::::::::::::::::::
CAGCTGCTGCTCCCCTGACAGACCACATGTGCCTGAATGTCAACGTAACAGAGGTCATCAAGAGCTCCAACTTGGCTGGAAGGTCCTTCTCTACAGTGAC
P--A--A--A--P--L--T--D--H--M--C--L--N--V--N--V--T--E--V--I--K--S--S--N--L--A--G--R--S--F--S--T--V--T

----------------------------------------------------------------------------------------------------
--N--T--F--R--T--N--N--I--Q--I--Q--S--R--D--Q--R--L--L--T--L--S--L--D--K--D--D--Q--R--T--F--R--D--V-
CAACACCTTCAGGACGAACAATATCCAGATCCAGAGCCGGGACCAGAGGCTGCTGACACTGTCGCTGGACAAGGACGATCAACGCACTTTCAGGGATGTG
 ::::::::: :::::. :::.::::::::::::::.:.::::::::..:::::::::::: :::::::::::::::.:::.:: :: ::::.:::.:::
AAACACCTTCCGGACGGCCAACATCCAGATCCAGAGTCAGGACCAGAAACTGCTGACACTGACGCTGGACAAGGACGGTCAGCGAACGTTCAAGGACGTG
--N--T--F--R--T--A--N--I--Q--I--Q--S--Q--D--Q--K--L--L--T--L--T--L--D--K--D--G--Q--R--T--F--K--D--V-

----><----------------------------------------------------------------------------------------------
-V--R--F--E--V--A--P--C--P--E--P--C--S--G--A--Q--K--S--K--A--P--W--L--N--L--H--G--Q--Q--E--V--E--A--
GTCAGATTCGAGGTTGCTCCCTGCCCAGAACCATGTTCTGGGGCCCAGAAGTCCAAGGCACCGTGGCTCAATTTGCATGGGCAACAGGAGGTGGAAGCAA
:::   :::::::::::::::::::::::.::.:::::..::::::::::..::::::: .::::::: :.::..::::::   ::::::.:::::. .:
GTC---TTCGAGGTTGCTCCCTGCCCAGAGCCGTGTTCCAGGGCCCAGAAACCCAAGGCCTCGTGGCTGAGTTCACATGGG---CAGGAGATGGAAAGGA
-V-----F--E--V--A--P--C--P--E--P--C--S--R--A--Q--K--P--K--A--S--W--L--S--S--H--G-----Q--E--M--E--R--

------------------------------------------------------------->
I--K--A--K--P--K--P--L--L--M--P--I--N--T--F--S--G--I--V--Q--*-
TCAAAGCCAAGCCCAAGCCCCTTCTGATGCCCATCAACACATTCTCTGGTATTGTCCAGTGA
.:::::::::: ::::.::::::::.::::::::::::::.::::::::.::.:::::.:::
CCAAAGCCAAGGCCAAACCCCTTCTAATGCCCATCAACACGTTCTCTGGCATCGTCCAATGA
T--K--A--K--A--K--P--L--L--M--P--I--N--T--F--S--G--I--V--Q--*-

Pig Consensus Sequence

>BGISUST0000881457
---------------GTGGAGCTGGATCTGCAGCGGAGCGTACAGGCTGTGCTCAGGGAGCTCAGTGCCCAGGCCCCCGCCCTGCAGAGCAACCAA---A
TGTGCAGGTGGTCCCTGCACAAGAAGGTGGAGCGAGATCCCGGTAAGAGTCCGGCGCTGGTCCGCATTCTGCTCAGAGAACTGGAGAAGGCAGAAAGGGA
GGACACCCGGCATGTCATCCTTCCCCTGCTGCACACGCTCATGTACGTGCTCACTAAG------------------------------------------
----------------------------------------------------------------------------------------------------
--------------------------------------------------------------GTCTTCCTCTTCGTGGATCCTGAGCTGGTGTCTCCTTC
CGTGTGCAGTGCCCTGCTGCTGGAGCTGCAGGCGGCCCAAGAGCAGCAGACGCCCGAGGCCTGCATGCGCCACGTGGTCTCCCACGCGCTGCAGGCGGCG
CTGGGGGAGGCCTGCCAGGCAGGCGCACTGCAAAAGAGGCTGCAG-------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
------------------------------------------------------------------------------TCAGGGCCCACCCACTGGACCC
CAGCTGCTGCTCCCCTGACAGACCACATGTGCCTGAATGTCAACGTAACAGAGGTCATCAAGAGCTCCAACTTGGCTGGAAGGTCCTTCTCTACAGTGAC
AAACACCTTCCGGACGGCCAACATCCAGATCCAGAGTCAGGACCAGAAACTGCTGACACTGACGCTGGACAAGGACGGTCAGCGAACGTTCAAGGACGTG
GTC---TTCGAGGTTGCTCCCTGCCCAGAGCCGTGTTCCAGGGCCCAGAAACCCAAGGCCTCGTGGCTGAGTTCACATGGGCAGGAGATGGAAAGGACCA
AAGCCAAGGCCAAACCCCTTCTAATGCCCATCAACACGTTCTCTGGCATCGTCCAATGA


>BGISUSP0000881457
-----VELDLQRSVQAVLRELSAQAPALQSNQ-MCRWSLHKKVERDPGKSPALVRILLRELEKAEREDTRHVILPLLHTLMYVLTK--------------
------------------------------------------------------VFLFVDPELVSPSVCSALLLELQAAQEQQTPEACMRHVVSHALQAA
LGEACQAGALQKRLQ-------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
--------------------------SGPTHWTPAAAPLTDHMCLNVNVTEVIKSSNLAGRSFSTVTNTFRTANIQIQSQDQKLLTLTLDKDGQRTFKDV
V-FEVAPCPEPCSRAQKPKASWLSSHGQEMERTKAKAKPLLMPINTFSGIVQ*