Sequences
EST Library Info
tes3Testes
Clusters
Oligos
SNPs

Gene ID ENSG00000172717 (click for geneview)
Transcript ID ENST00000311864(link to ensembl)
Symbol CN054_HUMAN
Localtion Chromosome:14:66725899:66765020:1 band: 14q23.3
Description  
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--K--K--N--T--S--K--T--T--M--R--I--N--K--Q--D--A--L--C--T--P--H--S--H--D--P--R--D--L--Q--N--M--L--
ATGAAGAAGAACACCAGCAAGACTACCATGAGGATCAATAAGCAAGATGCTCTCTGCACCCCACACTCCCATGATCCGAGAGATCTTCAAAATATGTTGG
:::::::::::.: ::: ::: ::.:::.::::::::::.:: ::::.: . ::::::.:::: ::::::: :::::..:::: ::::::::::::::::
ATGAAGAAGAATAACAGGAAGTCTGCCACGAGGATCAATGAGGAAGACGACATCTGCATCCCAGACTCCCAGGATCCAGGAGAGCTTCAAAATATGTTGG
-M--K--K--N--N--R--K--S--A--T--R--I--N--E--E--D--D--I--C--I--P--D--S--Q--D--P--G--E--L--Q--N--M--L--

----------------------------------------------------------><----------------------------------------
D--G--G--E--Y--A--P--F--V--S--P--P--M--L--E--S--N--F--I--Q--V--N--R--R--G--E--S--I--Y--L--H--N--R--A
ATGGAGGAGAGTATGCCCCTTTTGTATCTCCTCCCATGTTAGAGAGCAATTTTATCCAGGTCAACAGAAGAGGTGAATCCATTTACCTTCATAACCGAGC
:::::::::::::.:::::.:::::.:::::::::::.:::::.:::::::::::::::::::::::.:::::::::::::::::::: :::::.:::::
ATGGAGGAGAGTACGCCCCCTTTGTGTCTCCTCCCATATTAGAAAGCAATTTTATCCAGGTCAACAGGAGAGGTGAATCCATTTACCTGCATAATCGAGC
D--G--G--E--Y--A--P--F--V--S--P--P--I--L--E--S--N--F--I--Q--V--N--R--R--G--E--S--I--Y--L--H--N--R--A

----------------------------------------------------------------------------------------------------
--N--W--V--T--V--G--I--C--F--S--S--S--T--H--K--I--P--N--V--M--L--L--A--H--L--T--P--G--A--Q--K--D--T-
CAACTGGGTGACCGTAGGCATCTGTTTTTCCAGCTCCACCCACAAGATCCCCAATGTGATGCTACTGGCCCATCTGACACCTGGTGCCCAAAAAGATACA
::::::::::::.::.::::::::.:.::::::..::::::::::::::::::::::::::::.::::: ::::::::::::: .:::::.::.::. : 
CAACTGGGTGACTGTGGGCATCTGCTCTTCCAGTCCCACCCACAAGATCCCCAATGTGATGCTGCTGGCACATCTGACACCTGCCGCCCAGAAGGACTCC
--N--W--V--T--V--G--I--C--S--S--S--P--T--H--K--I--P--N--V--M--L--L--A--H--L--T--P--A--A--Q--K--D--S-

----------------------------------------------------------><----------------------------------------
-E--T--L--F--K--S--L--L--T--S--P--P--A--E--K--L--V--L--T--R--F--L--P--L--Q--F--V--T--L--S--V--H--D--
GAAACCCTGTTTAAAAGTCTCCTGACATCTCCTCCTGCAGAGAAACTAGTGCTCACCAGGTTTCTCCCTCTGCAGTTTGTGACTCTTTCTGTGCATGATG
::: ::::::::.:::::::.::::::::::::.:: ::::::::::.:::::::::   ::::::::::::::::::::::::::::::::::::::.:
GAACCCCTGTTTGAAAGTCTTCTGACATCTCCTTCTTCAGAGAAACTGGTGCTCACC---TTTCTCCCTCTGCAGTTTGTGACTCTTTCTGTGCATGACG
-E--P--L--F--E--S--L--L--T--S--P--S--S--E--K--L--V--L--T-----F--L--P--L--Q--F--V--T--L--S--V--H--D--

----------------------------------------------------------------------------------------------------
A--E--N--M--S--L--K--V--K--L--V--S--G--R--A--Y--Y--L--Q--L--C--T--S--A--Y--K--Q--D--T--L--F--S--Q--W
CGGAGAACATGAGCCTGAAAGTAAAGCTGGTGAGTGGTCGAGCCTACTACTTACAGCTCTGCACCTCTGCATATAAACAGGACACCTTGTTTTCTCAATG
: :::::.::: :: : ::::::::::::::::::::.::::::::::::.:::::::::::.::.: :: :..:::::.::::: .:.:::: :::.::
CTGAGAATATGCGCATCAAAGTAAAGCTGGTGAGTGGCCGAGCCTACTACCTACAGCTCTGCGCCCCGGCCTGCAAACAAGACACGCTATTTTGTCAGTG
A--E--N--M--R--I--K--V--K--L--V--S--G--R--A--Y--Y--L--Q--L--C--A--P--A--C--K--Q--D--T--L--F--C--Q--W

----------------------------------------------------------------------------------------------------
--V--A--L--I--S--L--L--N--Q--E--K--A--K--V--S--K--V--S--E--V--S--S--L--S--G--I--T--N--S--T--D--I--T-
GGTGGCCCTCATCTCCCTCTTGAATCAGGAGAAAGCCAAAGTTTCCAAAGTGTCGGAGGTTTCAAGTCTCTCAGGAATTACGAATAGCACAGACATCACA
:::::  ::::::::::::::::::::::::::::::::::.:::::::::::::::.::.:: ::.:::::.:.:::.::.:::::::: :::::::::
GGTGGAACTCATCTCCCTCTTGAATCAGGAGAAAGCCAAAGCTTCCAAAGTGTCGGAAGTCTCCAGCCTCTCGGAAATCACAAATAGCACCGACATCACA
--V--E--L--I--S--L--L--N--Q--E--K--A--K--A--S--K--V--S--E--V--S--S--L--S--E--I--T--N--S--T--D--I--T-

----------------------------------------------------------------------------------------------------
-G--S--M--D--V--T--D--V--T--T--F--T--A--I--L--T--P--Y--M--Y--A--G--T--G--P--E--H--V--R--D--S--I--D--
GGCTCCATGGATGTGACGGATGTCACCACGTTCACAGCCATCCTGACCCCGTACATGTATGCAGGTACAGGCCCTGAACATGTCAGGGACAGCATAGATT
::::::.::::..: :.::::.:..: .: ::::::::.:: : :.::.::.:: ::.:..:: :: :::.:::.         : .:: ::::. ::::
GGCTCCGTGGACATCATGGATATTGCAGCCTTCACAGCTATGCAGGCCTCGCACCTGCACACATGTTCAGACCCC---------ATAGAAAGCACTGATT
-G--S--V--D--I--M--D--I--A--A--F--T--A--M--Q--A--S--H--L--H--T--C--S--D--P-----------I--E--S--T--D--

----------------------------------------------------------------------------------------------------
F--P--E--F--T--D--I--T--D--I--T--D--V--T--D--L--P--E--N--E--V--P--E--V--P--D--V--R--I--V--T--E--V--I
TCCCAGAATTCACAGACATCACCGACATCACAGATGTCACAGATCTTCCAGAAAATGAGGTCCCAGAGGTCCCGGATGTAAGAATTGTCACAGAAGTCAT
::.::::::::::.:::.::::::::.:::: :::::.:::::: ::::::::::::::.:: ::::::.:::.:::                       
TCTCAGAATTCACGGACGTCACCGACGTCACCGATGTTACAGATGTTCCAGAAAATGAGATCACAGAGGCCCCAGAT-----------------------
F--S--E--F--T--D--V--T--D--V--T--D--V--T--D--V--P--E--N--E--I--T--E--A--P--D------------------------

----------------------------------------------------------------------------------------------------
--E--V--R--E--A--T--E--V--T--D--S--S--D--I--T--N--C--S--G--V--T--V--V--F--E--N--N--D--L--I--R--A--K-
AGAAGTCAGAGAAGCCACGGAAGTCACAGACAGCTCTGATATTACAAACTGCTCGGGAGTCACAGTGGTGTTTGAAAACAATGACTTAATCAGGGCCAAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----------><---------------------------------------------------------------------------------------
-Q--E--E--K--E--K--L--K--N--I--L--K--P--G--C--L--Q--D--T--K--S--K--S--E--L--K--E--S--S--K--H--V--T--
CAAGAGGAGAAGGAAAAATTGAAAAACATTCTGAAGCCTGGGTGTTTACAAGATACAAAAAGTAAGAGTGAGTTGAAAGAATCCTCAAAACATGTCACCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
I--S--N--I--T--L--T--F--E--G--K--R--Y--F--Q--T--T--L--T--P--V--E--S--E--A--N--T--S--K--E--M--K--D--K
TCTCAAACATAACACTGACTTTTGAAGGTAAAAGATATTTTCAAACTACCTTGACCCCAGTAGAAAGTGAGGCAAATACATCCAAGGAGATGAAGGATAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----------------------------------------------------------><---------------------------><----------
--T--S--E--E--K--M--P--D--F--Q--S--T--A--L--K--A--E--E--S--R--S--L--R--T--E--S--N--T--S--V--L--S--P-
GACCTCTGAAGAAAAGATGCCTGATTTTCAGAGCACAGCTCTCAAGGCTGAAGAATCCAGGAGCTTGAGAACTGAATCAAACACTTCAGTTCTCTCCCCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------------------------------------------------->
-H--I--K--S--P--S--N--F--L--K--L--V--P--H--L--S--A--P--F--S--R--E--*-
CATATCAAATCTCCTTCTAATTTCCTCAAACTTGTGCCTCATCTGTCTGCCCCTTTCTCAAGGGAATGA
                                                                     
---------------------------------------------------------------------
---------------------------------------------------------------------

Pig Consensus Sequence

>BGISUST0000895016
ATGAAGAAGAATAACAGGAAGTCTGCCACGAGGATCAATGAGGAAGACGACATCTGCATCCCAGACTCCCAGGATCCAGGAGAGCTTCAAAATATGTTGG
ATGGAGGAGAGTACGCCCCCTTTGTGTCTCCTCCCATATTAGAAAGCAATTTTATCCAGGTCAACAGGAGAGGTGAATCCATTTACCTGCATAATCGAGC
CAACTGGGTGACTGTGGGCATCTGCTCTTCCAGTCCCACCCACAAGATCCCCAATGTGATGCTGCTGGCACATCTGACACCTGCCGCCCAGAAGGACTCC
GAACCCCTGTTTGAAAGTCTTCTGACATCTCCTTCTTCAGAGAAACTGGTGCTCACC---TTTCTCCCTCTGCAGTTTGTGACTCTTTCTGTGCATGACG
CTGAGAATATGCGCATCAAAGTAAAGCTGGTGAGTGGCCGAGCCTACTACCTACAGCTCTGCGCCCCGGCCTGCAAACAAGACACGCTATTTTGTCAGTG
GGTGGAACTCATCTCCCTCTTGAATCAGGAGAAAGCCAAAGCTTCCAAAGTGTCGGAAGTCTCCAGCCTCTCGGAAATCACAAATAGCACCGACATCACA
GGCTCCGTGGACATCATGGATATTGCAGCCTTCACAGCTATGCAGGCCTCGCACCTGCACACATGTTCAGACCCCATAGAAAGCACTGATTTCTCAGAAT
TCACGGACGTCACCGACGTCACCGATGTTACAGATGTTCCAGAAAATGAGATCACAGAGGCCCCAGAT--------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
------------------------------------------------------------


>BGISUSP0000895016
MKKNNRKSATRINEEDDICIPDSQDPGELQNMLDGGEYAPFVSPPILESNFIQVNRRGESIYLHNRANWVTVGICSSSPTHKIPNVMLLAHLTPAAQKDS
EPLFESLLTSPSSEKLVLT-FLPLQFVTLSVHDAENMRIKVKLVSGRAYYLQLCAPACKQDTLFCQWVELISLLNQEKAKASKVSEVSSLSEITNSTDIT
GSVDIMDIAAFTAMQASHLHTCSDPIESTDFSEFTDVTDVTDVTDVPENEITEAPD--------------------------------------------
----------------------------------------------------------------------------------------------------
--------------------