Sequences
EST Library Info
plac1Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000174177 (click for geneview)
Transcript ID ENST00000312060(link to ensembl)
Symbol NP_001012780.1
Localtion Chromosome:16:87303868:87309285:1 band: 16q24.3
Description LOC348180 protein (Fragment).
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-------------------------------------------------------><------------------------------------------
-V--H--K--F--R--A--M--L--G--K--N--R--L--I--F--P--G--E--K--V--L--L--A--W--S--G--G--P--S--S--S--S--M--
GTCCACAAGTTCAGAGCCATGCTGGGCAAGAACCGGCTCATCTTTCCAGGCGAGAAGGTGCTCTTGGCGTGGTCTGGGGGGCCTTCGTCCAGCTCCATGG
   :::::::::::::::.:::: :: ::::::::::: :::::.::::: ::::::::::: .::::::::::::::::::::::::::::::::::::
---CACAAGTTCAGAGCCGTGCTCGGGAAGAACCGGCTGATCTTCCCAGGAGAGAAGGTGCTGCTGGCGTGGTCTGGGGGGCCTTCGTCCAGCTCCATGG
----H--K--F--R--A--V--L--G--K--N--R--L--I--F--P--G--E--K--V--L--L--A--W--S--G--G--P--S--S--S--S--M--

----------------><-----------------------------------------------------------><---------------------
V--W--Q--V--L--E--G--L--S--Q--D--S--A--K--R--L--R--F--V--A--G--V--I--F--V--D--E--G--A--A--C--G--Q--S
TCTGGCAGGTTCTTGAGGGCCTGAGCCAAGATTCTGCCAAAAGACTGCGCTTTGTGGCAGGAGTCATCTTTGTTGACGAGGGAGCAGCCTGTGGCCAGAG
::::::::::.::.:::                                                                                   
TCTGGCAGGTCCTCGAG-----------------------------------------------------------------------------------
V--W--Q--V--L--E------------------------------------------------------------------------------------

---------------------------------------------------------------------------------------><-----------
--L--E--E--R--S--K--T--L--A--E--V--K--P--I--L--Q--A--T--G--F--P--W--H--V--V--A--L--E--E--V--F--S--L-
CCTAGAGGAGAGATCAAAGACCCTGGCCGAAGTGAAGCCCATTCTGCAAGCAACTGGGTTCCCATGGCATGTGGTGGCCTTAGAGGAGGTGTTCAGCCTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-P--P--S--V--L--W--C--S--A--Q--E--L--V--G--S--E--G--A--Y--K--A--A--V--D--S--F--L--Q--Q--Q--H--V--L--
CCACCGTCGGTGCTTTGGTGCTCTGCCCAGGAGCTGGTGGGATCCGAGGGGGCCTACAAGGCGGCCGTGGACAGCTTCCTCCAGCAGCAGCATGTGCTGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
G--A--G--G--G--P--G--P--T--Q--G--E--E--Q--P--P--Q--P--P--L--D--P--Q--N--L--A--R--P--P--A--P--A--Q--T
GGGCCGGGGGTGGTCCTGGCCCGACTCAAGGGGAGGAACAGCCACCCCAGCCCCCGCTGGACCCCCAGAACCTGGCAAGACCGCCTGCCCCTGCCCAGAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----------------------------------------------------------------------><---------------------------
--E--A--L--S--Q--L--F--C--S--V--R--T--L--T--A--K--E--E--L--L--Q--T--L--R--T--H--L--I--L--H--M--A--R-
TGAGGCTCTTTCCCAACTGTTCTGCTCAGTGAGGACACTGACTGCCAAGGAGGAGCTTCTGCAGACCCTGCGGACCCACCTGATCCTCCACATGGCCCGA
                                                                         ::::::.:::: :::::..:::::::.
-------------------------------------------------------------------------ACCCACTTGATGCTCCATGTGGCCCGG
--------------------------------------------------------------------------T--H--L--M--L--H--V--A--R-

----------------------------------------------------------------------------------------------------
-A--H--G--Y--S--K--V--M--T--G--D--S--C--T--R--L--A--I--K--L--M--T--N--L--A--L--G--R--G--A--F--L--A--
GCCCACGGCTACTCCAAGGTCATGACTGGGGACAGCTGCACACGCTTGGCTATCAAGCTCATGACCAACCTGGCGCTGGGTCGAGGGGCCTTCCTGGCCT
.::::::::::::::::.:: ::::: :: :::::::::::::::.::::..:::.:::: ::::::.::::::::::::  ::::::::::::: ::::
ACCCACGGCTACTCCAAAGTGATGACGGGCGACAGCTGCACACGCCTGGCCGTCAGGCTCCTGACCAGCCTGGCGCTGGGGAGAGGGGCCTTCCTCGCCT
-T--H--G--Y--S--K--V--M--T--G--D--S--C--T--R--L--A--V--R--L--L--T--S--L--A--L--G--R--G--A--F--L--A--

-------><-------------------------------------------------------------------------------------------
W--D--T--G--F--S--D--E--R--H--G--D--V--V--V--V--R--P--M--R--D--H--T--L--K--E--V--A--F--Y--N--R--L--F
GGGATACGGGCTTCTCGGATGAGCGGCACGGGGACGTGGTGGTGGTGCGGCCCATGCGGGACCACACCCTGAAGGAGGTCGCTTTCTACAACCGCCTGTT
::::.::::::::::::::.::::::::::: :::::::::::::::::::::::::: :: ::::: ::::::::::::::.:::::::::::::::::
GGGACACGGGCTTCTCGGACGAGCGGCACGGCGACGTGGTGGTGGTGCGGCCCATGCGTGAGCACACGCTGAAGGAGGTCGCCTTCTACAACCGCCTGTT
W--D--T--G--F--S--D--E--R--H--G--D--V--V--V--V--R--P--M--R--E--H--T--L--K--E--V--A--F--Y--N--R--L--F

---------------------------------------><-----------------------------------------------------------
--S--V--P--S--V--F--T--P--A--V--D--T--K--A--P--E--K--A--S--I--H--R--L--M--E--A--F--I--L--R--L--Q--T-
CTCCGTTCCTTCTGTCTTCACACCAGCCGTCGACACCAAGGCCCCTGAAAAGGCCAGCATCCACCGGCTGATGGAGGCCTTCATCCTCAGGCTGCAGACC
: ::::.::.::.::::::::.::.:::.::::::::::::::.::::::::::::::.::::::::::::::::::::::: : ::::::::::::.: 
CGCCGTCCCCTCCGTCTTCACGCCGGCCATCGACACCAAGGCCTCTGAAAAGGCCAGCGTCCACCGGCTGATGGAGGCCTTCCTGCTCAGGCTGCAGGCG
--A--V--P--S--V--F--T--P--A--I--D--T--K--A--S--E--K--A--S--V--H--R--L--M--E--A--F--L--L--R--L--Q--A-

-------------------------------><-------------------------------------------------------------------
-Q--F--P--S--T--V--S--T--V--Y--R--T--S--E--K--L--V--K--G--P--R--D--G--P--A--A--G--D--S--G--P--R--C--
CAGTTCCCCTCCACTGTCAGCACTGTGTACAGGACAAGTGAGAAGCTGGTGAAGGGCCCCCGGGATGGCCCTGCTGCTGGCGACTCCGGCCCCCGCTGCC
:.::::::::::::.::::::::.::::::                                                                      
CGGTTCCCCTCCACCGTCAGCACCGTGTAC----------------------------------------------------------------------
-R--F--P--S--T--V--S--T--V--Y-----------------------------------------------------------------------

------------------------------------------------------------->
L--L--C--M--C--A--L--D--V--D--A--A--G--L--C--F--M--L--L--G--*-
TCCTCTGCATGTGTGCCCTGGACGTCGACGCCGCTGGTCTGTGTTTCATGCTCTTGGGGTGA
                                                              
--------------------------------------------------------------
--------------------------------------------------------------

Pig Consensus Sequence

>BGISUST0000896995
---CACAAGTTCAGAGCCGTGCTCGGGAAGAACCGGCTGATCTTCCCAGGAGAGAAGGTGCTGCTGGCGTGGTCTGGGGGGCCTTCGTCCAGCTCCATGG
TCTGGCAGGTCCTCGAG-----------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-------------------------------------------------------------------------ACCCACTTGATGCTCCATGTGGCCCGG
ACCCACGGCTACTCCAAAGTGATGACGGGCGACAGCTGCACACGCCTGGCCGTCAGGCTCCTGACCAGCCTGGCGCTGGGGAGAGGGGCCTTCCTCGCCT
GGGACACGGGCTTCTCGGACGAGCGGCACGGCGACGTGGTGGTGGTGCGGCCCATGCGTGAGCACACGCTGAAGGAGGTCGCCTTCTACAACCGCCTGTT
CGCCGTCCCCTCCGTCTTCACGCCGGCCATCGACACCAAGGCCTCTGAAAAGGCCAGCGTCCACCGGCTGATGGAGGCCTTCCTGCTCAGGCTGCAGGCG
CGGTTCCCCTCCACCGTCAGCACCGTGTAC----------------------------------------------------------------------
--------------------------------------------------------------


>BGISUSP0000896995
-HKFRAVLGKNRLIFPGEKVLLAWSGGPSSSSMVWQVLE-------------------------------------------------------------
-------------------------------------------------------------------------------------------THLMLHVAR
THGYSKVMTGDSCTRLAVRLLTSLALGRGAFLAWDTGFSDERHGDVVVVRPMREHTLKEVAFYNRLFAVPSVFTPAIDTKASEKASVHRLMEAFLLRLQA
RFPSTVSTVY--------------------------------------------