Sequences
EST Library Info
plac2Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000125434 (click for geneview)
Transcript ID ENST00000312524(link to ensembl)
Symbol NP_958928.1
Localtion Chromosome:17:8131807:8139386:-1 band: 17p13.1
Description similar to 1810012H11Rik
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--D--F--L--M--S--G--L--A--A--C--G--A--C--V--F--T--N--P--L--E--V--V--K--T--R--M--Q--L--Q--G--E--L--
ATGGACTTCTTGATGAGTGGCCTGGCAGCCTGCGGGGCCTGTGTATTCACCAATCCCCTGGAGGTGGTGAAGACCAGGATGCAGTTGCAAGGAGAACTGC
:::::::::::::::::.::::::::::::::.::::::::: :.:::::::::::::::::::::::::::::::::::::::.::::.::::::::::
ATGGACTTCTTGATGAGCGGCCTGGCAGCCTGTGGGGCCTGTTTGTTCACCAATCCCCTGGAGGTGGTGAAGACCAGGATGCAGCTGCAGGGAGAACTGC
-M--D--F--L--M--S--G--L--A--A--C--G--A--C--L--F--T--N--P--L--E--V--V--K--T--R--M--Q--L--Q--G--E--L--

----------------------------------------------------------------------------------------------------
Q--A--P--G--T--Y--Q--R--H--Y--R--N--V--F--H--A--F--I--T--I--G--K--V--D--G--L--A--A--L--Q--K--G--L--A
AGGCCCCTGGCACATACCAGCGGCACTACCGAAATGTCTTCCATGCCTTCATCACCATCGGCAAGGTGGATGGCCTTGCTGCCCTGCAGAAAGGCCTGGC
::::::::::::: :::::.::::::::::::::.::::::::::::::::::::::::::::.::::::::::::.:::::::::::.::::: :::::
AGGCCCCTGGCACCTACCAACGGCACTACCGAAACGTCTTCCATGCCTTCATCACCATCGGCAGGGTGGATGGCCTCGCTGCCCTGCAAAAAGGGCTGGC
Q--A--P--G--T--Y--Q--R--H--Y--R--N--V--F--H--A--F--I--T--I--G--R--V--D--G--L--A--A--L--Q--K--G--L--A

----------------------------------------------------------------------------------------------------
--P--A--L--L--Y--Q--F--L--M--N--G--I--R--L--G--T--Y--G--L--A--E--A--G--G--Y--L--H--T--A--E--G--T--H-
CCCCGCCCTCTTGTACCAGTTCCTGATGAATGGCATCCGACTGGGCACCTATGGGCTGGCTGAGGCTGGGGGCTACCTGCACACAGCCGAAGGCACCCAC
::: ::::::::.::::::::::::::::::::::::::.:::::::::::.:::::::::::.::::::::::::::::::::.::.:::::::::: :
CCCGGCCCTCTTATACCAGTTCCTGATGAATGGCATCCGGCTGGGCACCTACGGGCTGGCTGAAGCTGGGGGCTACCTGCACACGGCTGAAGGCACCCTC
--P--A--L--L--Y--Q--F--L--M--N--G--I--R--L--G--T--Y--G--L--A--E--A--G--G--Y--L--H--T--A--E--G--T--L-

--------------------------------------------------------------------------><------------------------
-S--P--A--R--S--A--A--A--G--A--M--A--G--V--M--G--A--Y--L--G--S--P--I--Y--M--V--K--T--H--L--Q--A--Q--
AGTCCTGCCCGCAGCGCAGCAGCTGGGGCCATGGCTGGGGTCATGGGAGCCTACTTGGGGAGCCCCATCTACATGGTGAAGACACACCTGCAGGCACAGG
::.::::.:::::::::.:::::::::::  ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.::::::::::
AGCCCTGTCCGCAGCGCGGCAGCTGGGGCGCTGGCTGGGGTCATGGGAGCCTACTTGGGGAGCCCCATCTACATGGTGAAGACACACCTACAGGCACAGG
-S--P--V--R--S--A--A--A--G--A--L--A--G--V--M--G--A--Y--L--G--S--P--I--Y--M--V--K--T--H--L--Q--A--Q--

----------------------------------------><----------------------------------------------------------
A--A--S--E--I--A--V--G--H--Q--Y--K--H--Q--G--M--F--Q--A--L--T--E--I--G--Q--K--H--G--L--V--G--L--W--R
CAGCCTCAGAAATTGCTGTAGGGCACCAGTATAAGCATCAGGGCATGTTTCAGGCGCTAACCGAGATTGGCCAGAAACATGGTCTGGTGGGGTTATGGCG
:::::::::::::::::::::::::::::::::::::::::                                                           
CAGCCTCAGAAATTGCTGTAGGGCACCAGTATAAGCATCAG-----------------------------------------------------------
A--A--S--E--I--A--V--G--H--Q--Y--K--H--Q------------------------------------------------------------

---------------------------------------------------------------------------------------------><-----
--G--A--L--G--G--L--P--R--V--I--V--G--S--S--T--Q--L--C--T--F--S--S--T--K--D--L--L--S--Q--W--E--I--F-
TGGGGCTCTGGGCGGCCTGCCCCGAGTTATCGTCGGTTCCTCCACCCAGCTGTGCACCTTCTCATCCACCAAGGACCTCCTGAGCCAGTGGGAGATCTTT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-P--P--Q--S--W--K--L--A--L--V--A--A--M--M--S--G--I--A--V--V--L--A--M--A--P--F--D--V--A--C--T--R--L--
CCTCCCCAGAGCTGGAAGTTGGCGCTGGTGGCTGCCATGATGAGTGGCATTGCAGTTGTCTTGGCCATGGCACCCTTTGATGTGGCCTGCACAAGGCTCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------><----------------------------------------------------------------------
Y--N--Q--P--T--D--A--Q--G--K--N--R--V--P--K--F--S--A--T--S--C--S--A--S--A--P--L--L--G--T--K--D--V--R
ACAACCAGCCCACAGATGCACAGGGCAAGAACCGAGTCCCCAAGTTCTCAGCAACATCATGCAGTGCTTCAGCGCCTTTACTGGGGACCAAAGATGTTAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----------------------------------------------------------><-------------------------->
--I--V--K--G--Q--T--G--H--Q--L--F--K--V--T--Q--A--P--G--C--S--P--I--L--L--G--T--Q--S--*-
GATCGTGAAGGGTCAGACTGGTCACCAGCTGTTCAAAGTCACCCAGGCTCCAGGGTGCAGCCCGATTCTCCTGGGAACCCAGTCATGA
                                                                                        
----------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------

Pig Consensus Sequence

>BGISUST0000901919
ATGGACTTCTTGATGAGCGGCCTGGCAGCCTGTGGGGCCTGTTTGTTCACCAATCCCCTGGAGGTGGTGAAGACCAGGATGCAGCTGCAGGGAGAACTGC
AGGCCCCTGGCACCTACCAACGGCACTACCGAAACGTCTTCCATGCCTTCATCACCATCGGCAGGGTGGATGGCCTCGCTGCCCTGCAAAAAGGGCTGGC
CCCGGCCCTCTTATACCAGTTCCTGATGAATGGCATCCGGCTGGGCACCTACGGGCTGGCTGAAGCTGGGGGCTACCTGCACACGGCTGAAGGCACCCTC
AGCCCTGTCCGCAGCGCGGCAGCTGGGGCGCTGGCTGGGGTCATGGGAGCCTACTTGGGGAGCCCCATCTACATGGTGAAGACACACCTACAGGCACAGG
CAGCCTCAGAAATTGCTGTAGGGCACCAGTATAAGCATCAG-----------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------


>BGISUSP0000901919
MDFLMSGLAACGACLFTNPLEVVKTRMQLQGELQAPGTYQRHYRNVFHAFITIGRVDGLAALQKGLAPALLYQFLMNGIRLGTYGLAEAGGYLHTAEGTL
SPVRSAAAGALAGVMGAYLGSPIYMVKTHLQAQAASEIAVGHQYKHQ-----------------------------------------------------
------------------------------------------------------------------------------------------------