Sequences
EST Library Info
ebs1Foetus 50 days, brain stem
eje3Foetus 50 days, jejunum
fbs1Unavailable
hyp1Hypothalamus
Clusters
Oligos
SNPs

Gene ID ENSG00000186318 (click for geneview)
Transcript ID ENST00000313005(link to ensembl)
Symbol BACE1
Localtion Chromosome:11:116661627:116692182:-1 band: 11q23.3
Description Beta-secretase 1 precursor (EC 3.4.23.46) (Beta-site APP cleaving enzyme 1) (Beta-site amyloid precursor protein cleaving enzyme 1) (Aspartyl protease 2) (Asp 2) (ASP2) (Membrane-associated aspartic protease 2) (Memapsin-2). [Source:Uniprot/SWISSPROT;Acc:P56817]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--A--Q--A--L--P--W--L--L--L--W--M--G--A--G--V--L--P--A--H--G--T--Q--H--G--I--R--L--P--L--R--S--G--
ATGGCCCAAGCCCTGCCCTGGCTCCTGCTGTGGATGGGCGCGGGAGTGCTGCCTGCCCACGGCACCCAGCACGGCATCCGGCTGCCCCTGCGCAGCGGCC
::::::::::: :::::::::::::::::.::::::::: : ::.:::::::::::::::.:: :::::: .:::::::::::.:::::::: :::::::
ATGGCCCAAGCGCTGCCCTGGCTCCTGCTATGGATGGGCTCCGGGGTGCTGCCTGCCCACAGCCCCCAGCCTGGCATCCGGCTACCCCTGCGAAGCGGCC
-M--A--Q--A--L--P--W--L--L--L--W--M--G--S--G--V--L--P--A--H--S--P--Q--P--G--I--R--L--P--L--R--S--G--

----------------------------------------------------------------------------------------------------
L--G--G--A--P--L--G--L--R--L--P--R--E--T--D--E--E--P--E--E--P--G--R--R--G--S--F--V--E--M--V--D--N--L
TGGGGGGCGCCCCCCTGGGGCTGCGGCTGCCCCGGGAGACCGACGAAGAGCCCGAGGAGCCCGGCCGGAGGGGCAGCTTTGTGGAGATGGTGGACAACCT
: ::::: :: :::::::::::. ::::::::::::::::.:::::.:::::.::::::.::.::::::.:::::.::::::::::::::::::::::::
TTGGGGGGGCACCCCTGGGGCTAAGGCTGCCCCGGGAGACTGACGAGGAGCCTGAGGAGTCCAGCCGGAAGGGCAACTTTGTGGAGATGGTGGACAACCT
L--G--G--A--P--L--G--L--R--L--P--R--E--T--D--E--E--P--E--E--S--S--R--K--G--N--F--V--E--M--V--D--N--L

------------------------------------------------------------><--------------------------------------
--R--G--K--S--G--Q--G--Y--Y--V--E--M--T--V--G--S--P--P--Q--T--L--N--I--L--V--D--T--G--S--S--N--F--A-
GAGGGGCAAGTCGGGGCAGGGCTACTACGTGGAGATGACCGTGGGCAGCCCCCCGCAGACGCTCAACATCCTGGTGGATACAGGCAGCAGTAACTTTGCA
:::::::::::: :: ::::::::::::::::::::::::::::::::::::::.:::   :::::::::::::::::.:::::::::::::::::::: 
GAGGGGCAAGTCCGGTCAGGGCTACTACGTGGAGATGACCGTGGGCAGCCCCCCACAG---CTCAACATCCTGGTGGACACAGGCAGCAGTAACTTTGCT
--R--G--K--S--G--Q--G--Y--Y--V--E--M--T--V--G--S--P--P--Q-----L--N--I--L--V--D--T--G--S--S--N--F--A-

-------------------------------------------------><-------------------------------------------------
-V--G--A--A--P--H--P--F--L--H--R--Y--Y--Q--R--Q--L--S--S--T--Y--R--D--L--R--K--G--V--Y--V--P--Y--T--
GTGGGTGCTGCCCCCCACCCCTTCCTGCATCGCTACTACCAGAGGCAGCTGTCCAGCACATACCGGGACCTCCGGAAGGGTGTGTATGTGCCCTACACCC
::::: ::::::::::::::.:::::::::::::::::::::::::::   :::::::::::::::::::::::::::::::::::::::::::::::::
GTGGGGGCTGCCCCCCACCCTTTCCTGCATCGCTACTACCAGAGGCAG---TCCAGCACATACCGGGACCTCCGGAAGGGTGTGTATGTGCCCTACACCC
-V--G--A--A--P--H--P--F--L--H--R--Y--Y--Q--R--Q-----S--S--T--Y--R--D--L--R--K--G--V--Y--V--P--Y--T--

----------------------------------------------------------------------------------------------------
Q--G--K--W--E--G--E--L--G--T--D--L--V--S--I--P--H--G--P--N--V--T--V--R--A--N--I--A--A--I--T--E--S--D
AGGGCAAGTGGGAAGGGGAGCTGGGCACCGACCTGGTAAGCATCCCCCATGGCCCCAACGTCACTGTGCGTGCCAACATTGCTGCCATCACTGAATCAGA
:::::::::::::.:::::::::::::::::::::::.:::::::::::.:::::::::::::::::::: :::::::::::::::::::::::.:::::
AGGGCAAGTGGGAGGGGGAGCTGGGCACCGACCTGGTGAGCATCCCCCACGGCCCCAACGTCACTGTGCGGGCCAACATTGCTGCCATCACTGAGTCAGA
Q--G--K--W--E--G--E--L--G--T--D--L--V--S--I--P--H--G--P--N--V--T--V--R--A--N--I--A--A--I--T--E--S--D

------------------------------------------------------------------><--------------------------------
--K--F--F--I--N--G--S--N--W--E--G--I--L--G--L--A--Y--A--E--I--A--R--P--D--D--S--L--E--P--F--F--D--S-
CAAGTTCTTCATCAACGGCTCCAACTGGGAAGGCATCCTGGGGCTGGCCTATGCTGAGATTGCCAGGCCTGACGACTCCCTGGAGCCTTTCTTTGACTCT
:::::::::::::::.::::::::::::::.::::::::::::::::::::.:: :::::.::::::::.:::::::::.::::::: ::::::::.::.
CAAGTTCTTCATCAATGGCTCCAACTGGGAGGGCATCCTGGGGCTGGCCTACGCGGAGATCGCCAGGCCCGACGACTCCTTGGAGCCGTTCTTTGATTCC
--K--F--F--I--N--G--S--N--W--E--G--I--L--G--L--A--Y--A--E--I--A--R--P--D--D--S--L--E--P--F--F--D--S-

----------------------------------------------------------------------------------------------------
-L--V--K--Q--T--H--V--P--N--L--F--S--L--Q--L--C--G--A--G--F--P--L--N--Q--S--E--V--L--A--S--V--G--G--
CTGGTAAAGCAGACCCACGTTCCCAACCTCTTCTCCCTGCAGCTTTGTGGTGCTGGCTTCCCCCTCAACCAGTCTGAAGTGCTGGCCTCTGTCGGAGGGA
:::::::::::::::::::: :::::::::::::::::::::::.::.::.::.:::::::::::::::::::: :::::::::::::: ::.:: ::::
CTGGTAAAGCAGACCCACGTGCCCAACCTCTTCTCCCTGCAGCTCTGCGGCGCCGGCTTCCCCCTCAACCAGTCGGAAGTGCTGGCCTCGGTTGGTGGGA
-L--V--K--Q--T--H--V--P--N--L--F--S--L--Q--L--C--G--A--G--F--P--L--N--Q--S--E--V--L--A--S--V--G--G--

----><----------------------------------------------------------------------------------------------
S--M--I--I--G--G--I--D--H--S--L--Y--T--G--S--L--W--Y--T--P--I--R--R--E--W--Y--Y--E--V--I--I--V--R--V
GCATGATCATTGGAGGTATCGACCACTCGCTGTACACAGGCAGTCTCTGGTATACACCCATCCGGCGGGAGTGGTATTATGAGGTGATCATTGTGCGGGT
::::::::::.::.:::::::::::::::::::::::.:::::.::::::::.:::::::::::::::::::::::::::::::::::::::::::::::
GCATGATCATCGGGGGTATCGACCACTCGCTGTACACGGGCAGCCTCTGGTACACACCCATCCGGCGGGAGTGGTATTATGAGGTGATCATTGTGCGGGT
S--M--I--I--G--G--I--D--H--S--L--Y--T--G--S--L--W--Y--T--P--I--R--R--E--W--Y--Y--E--V--I--I--V--R--V

---------------------------------------><-----------------------------------------------------------
--E--I--N--G--Q--D--L--K--M--D--C--K--E--Y--N--Y--D--K--S--I--V--D--S--G--T--T--N--L--R--L--P--K--K-
GGAGATCAATGGACAGGATCTGAAAATGGACTGCAAGGAGTACAACTATGACAAGAGCATTGTGGACAGTGGCACCACCAACCTTCGTTTGCCCAAGAAA
::::::::::::::::::::::::::::::::::::::::::::::::.:::::::::::::: :::::::::::::::::::::::.::::::::::::
GGAGATCAATGGACAGGATCTGAAAATGGACTGCAAGGAGTACAACTACGACAAGAGCATTGTCGACAGTGGCACCACCAACCTTCGCTTGCCCAAGAAA
--E--I--N--G--Q--D--L--K--M--D--C--K--E--Y--N--Y--D--K--S--I--V--D--S--G--T--T--N--L--R--L--P--K--K-

-----------------------------------------><---------------------------------------------------------
-V--F--E--A--A--V--K--S--I--K--A--A--S--S--T--E--K--F--P--D--G--F--W--L--G--E--Q--L--V--C--W--Q--A--
GTGTTTGAAGCTGCAGTCAAATCCATCAAGGCAGCCTCCTCCACGGAGAAGTTCCCTGATGGTTTCTGGCTAGGAGAGCAGCTGGTGTGCTGGCAAGCAG
:::::::::::::: ::::::::::::::::::::::::   :::::::::::::: ::::::::::::.::::.::.::::::::::::::::::::::
GTGTTTGAAGCTGCCGTCAAATCCATCAAGGCAGCCTCC---ACGGAGAAGTTCCCAGATGGTTTCTGGTTAGGGGAACAGCTGGTGTGCTGGCAAGCAG
-V--F--E--A--A--V--K--S--I--K--A--A--S-----T--E--K--F--P--D--G--F--W--L--G--E--Q--L--V--C--W--Q--A--

-------------------------------------------------------------------------------------------><-------
G--T--T--P--W--N--I--F--P--V--I--S--L--Y--L--M--G--E--V--T--N--Q--S--F--R--I--T--I--L--P--Q--Q--Y--L
GCACCACCCCTTGGAACATTTTCCCAGTCATCTCACTCTACCTAATGGGTGAGGTTACCAACCAGTCCTTCCGCATCACCATCCTTCCGCAGCAATACCT
::::::::::::::::::::::::::::::::::::::::::::::::: ::.::.:::::.::::::::::::::::::::::::::.:::        
GCACCACCCCTTGGAACATTTTCCCAGTCATCTCACTCTACCTAATGGGGGAAGTCACCAATCAGTCCTTCCGCATCACCATCCTTCCACAG--------
G--T--T--P--W--N--I--F--P--V--I--S--L--Y--L--M--G--E--V--T--N--Q--S--F--R--I--T--I--L--P--Q---------

----------------------------------------------------------------------------------------------------
--R--P--V--E--D--V--A--T--S--Q--D--D--C--Y--K--F--A--I--S--Q--S--S--T--G--T--V--M--G--A--V--I--M--E-
GCGGCCAGTGGAAGATGTGGCCACGTCCCAAGACGACTGTTACAAGTTTGCCATCTCACAGTCATCCACGGGCACTGTTATGGGAGCTGTTATCATGGAG
                                                    :::::::::::::::::.::::::::.::::::::::::::::::::.
----------------------------------------------------ATCTCACAGTCATCCACAGGCACTGTCATGGGAGCTGTTATCATGGAA
-----------------------------------------------------I--S--Q--S--S--T--G--T--V--M--G--A--V--I--M--E-

---------------------------------------------------------------><-----------------------------------
-G--F--Y--V--V--F--D--R--A--R--K--R--I--G--F--A--V--S--A--C--H--V--H--D--E--F--R--T--A--A--V--E--G--
GGCTTCTACGTTGTCTTTGATCGGGCCCGAAAACGAATTGGCTTTGCTGTCAGCGCTTGCCATGTGCACGATGAGTTCAGGACGGCAGCGGTGGAAGGCC
:::::::::::::::::::::::::::::.::::::::::::::::: ::::::::.::::::   :::::::::::::::::.:::::.::::::::::
GGCTTCTACGTTGTCTTTGATCGGGCCCGGAAACGAATTGGCTTTGCGGTCAGCGCCTGCCAT---CACGATGAGTTCAGGACAGCAGCAGTGGAAGGCC
-G--F--Y--V--V--F--D--R--A--R--K--R--I--G--F--A--V--S--A--C--H-----H--D--E--F--R--T--A--A--V--E--G--

----------------------------------------------------------------------------------------------------
P--F--V--T--L--D--M--E--D--C--G--Y--N--I--P--Q--T--D--E--S--T--L--M--T--I--A--Y--V--M--A--A--I--C--A
CTTTTGTCACCTTGGACATGGAAGACTGTGGCTACAACATTCCACAGACAGATGAGTCAACCCTCATGACCATAGCCTATGTCATGGCTGCCATCTGCGC
:::::::::::..:::::::::::::::::::::::::::.::::::::::::::.::::::::::::::::::::::::::::::::::::::::::::
CTTTTGTCACCCCGGACATGGAAGACTGTGGCTACAACATCCCACAGACAGATGAATCAACCCTCATGACCATAGCCTATGTCATGGCTGCCATCTGCGC
P--F--V--T--P--D--M--E--D--C--G--Y--N--I--P--Q--T--D--E--S--T--L--M--T--I--A--Y--V--M--A--A--I--C--A

----------------------------------------------------------------------------------------------------
--L--F--M--L--P--L--C--L--M--V--C--Q--W--C--C--L--R--C--L--R--Q--Q--H--D--D--F--A--D--D--I--S--L--L-
CCTCTTCATGCTGCCACTCTGCCTCATGGTGTGTCAGTGGTGCTGCCTCCGCTGCCTGCGCCAGCAGCATGATGACTTTGCTGATGACATCTCCCTGCTG
:::::::::::::::::::::::::::::::::.::::::.:::::::::::::::::::::: :::::.::::::::::::::.:::::::::::::::
CCTCTTCATGCTGCCACTCTGCCTCATGGTGTGCCAGTGGCGCTGCCTCCGCTGCCTGCGCCATCAGCACGATGACTTTGCTGACGACATCTCCCTGCTG
--L--F--M--L--P--L--C--L--M--V--C--Q--W--R--C--L--R--C--L--R--H--Q--H--D--D--F--A--D--D--I--S--L--L-

----->
-K--*-
AAGTGA
::::::
AAGTGA
-K--*-

Pig Consensus Sequence

>BGISUST0000891061
ATGGCCCAAGCGCTGCCCTGGCTCCTGCTATGGATGGGCTCCGGGGTGCTGCCTGCCCACAGCCCCCAGCCTGGCATCCGGCTACCCCTGCGAAGCGGCC
TTGGGGGGGCACCCCTGGGGCTAAGGCTGCCCCGGGAGACTGACGAGGAGCCTGAGGAGTCCAGCCGGAAGGGCAACTTTGTGGAGATGGTGGACAACCT
GAGGGGCAAGTCCGGTCAGGGCTACTACGTGGAGATGACCGTGGGCAGCCCCCCACAG---CTCAACATCCTGGTGGACACAGGCAGCAGTAACTTTGCT
GTGGGGGCTGCCCCCCACCCTTTCCTGCATCGCTACTACCAGAGGCAG---TCCAGCACATACCGGGACCTCCGGAAGGGTGTGTATGTGCCCTACACCC
AGGGCAAGTGGGAGGGGGAGCTGGGCACCGACCTGGTGAGCATCCCCCACGGCCCCAACGTCACTGTGCGGGCCAACATTGCTGCCATCACTGAGTCAGA
CAAGTTCTTCATCAATGGCTCCAACTGGGAGGGCATCCTGGGGCTGGCCTACGCGGAGATCGCCAGGCCCGACGACTCCTTGGAGCCGTTCTTTGATTCC
CTGGTAAAGCAGACCCACGTGCCCAACCTCTTCTCCCTGCAGCTCTGCGGCGCCGGCTTCCCCCTCAACCAGTCGGAAGTGCTGGCCTCGGTTGGTGGGA
GCATGATCATCGGGGGTATCGACCACTCGCTGTACACGGGCAGCCTCTGGTACACACCCATCCGGCGGGAGTGGTATTATGAGGTGATCATTGTGCGGGT
GGAGATCAATGGACAGGATCTGAAAATGGACTGCAAGGAGTACAACTACGACAAGAGCATTGTCGACAGTGGCACCACCAACCTTCGCTTGCCCAAGAAA
GTGTTTGAAGCTGCCGTCAAATCCATCAAGGCAGCCTCC---ACGGAGAAGTTCCCAGATGGTTTCTGGTTAGGGGAACAGCTGGTGTGCTGGCAAGCAG
GCACCACCCCTTGGAACATTTTCCCAGTCATCTCACTCTACCTAATGGGGGAAGTCACCAATCAGTCCTTCCGCATCACCATCCTTCCACAG--------
----------------------------------------------------ATCTCACAGTCATCCACAGGCACTGTCATGGGAGCTGTTATCATGGAA
GGCTTCTACGTTGTCTTTGATCGGGCCCGGAAACGAATTGGCTTTGCGGTCAGCGCCTGCCAT---CACGATGAGTTCAGGACAGCAGCAGTGGAAGGCC
CTTTTGTCACCCCGGACATGGAAGACTGTGGCTACAACATCCCACAGACAGATGAATCAACCCTCATGACCATAGCCTATGTCATGGCTGCCATCTGCGC
CCTCTTCATGCTGCCACTCTGCCTCATGGTGTGCCAGTGGCGCTGCCTCCGCTGCCTGCGCCATCAGCACGATGACTTTGCTGACGACATCTCCCTGCTG
AAGTGA


>BGISUSP0000891061
MAQALPWLLLWMGSGVLPAHSPQPGIRLPLRSGLGGAPLGLRLPRETDEEPEESSRKGNFVEMVDNLRGKSGQGYYVEMTVGSPPQ-LNILVDTGSSNFA
VGAAPHPFLHRYYQRQ-SSTYRDLRKGVYVPYTQGKWEGELGTDLVSIPHGPNVTVRANIAAITESDKFFINGSNWEGILGLAYAEIARPDDSLEPFFDS
LVKQTHVPNLFSLQLCGAGFPLNQSEVLASVGGSMIIGGIDHSLYTGSLWYTPIRREWYYEVIIVRVEINGQDLKMDCKEYNYDKSIVDSGTTNLRLPKK
VFEAAVKSIKAAS-TEKFPDGFWLGEQLVCWQAGTTPWNIFPVISLYLMGEVTNQSFRITILPQ--------------------ISQSSTGTVMGAVIME
GFYVVFDRARKRIGFAVSACH-HDEFRTAAVEGPFVTPDMEDCGYNIPQTDESTLMTIAYVMAAICALFMLPLCLMVCQWRCLRCLRHQHDDFADDISLL
K*