Sequences
EST Library Info
che2Heart - RNA from China
cje1Jejunum - RNA from China
cut5Uterus - RNA from China
dbla1Unavailable
eje1Foetus 50 days, jejunum
fat1Fatt
hyp1Hypothalamus
jca1Joint capsule
lin1Large intestine
mcp1Mammae, collostrum producing
nlu2Newborn 115 days, lung
nmm2Newborn 115 days, mucosal membranes
ova2Ovary
pigca1Unavailable
pliv2Unavailable
pro1Prostata
ret1Retina
Clusters
Oligos
SNPs

Gene ID ENSG00000068793 (click for geneview)
Transcript ID ENST00000313077(link to ensembl)
Symbol CYFIP1
Localtion Chromosome:15:20444174:20555043:1 band: 15q11.2
Description cytoplasmic FMR1 interacting protein 1 [Source:RefSeq_peptide;Acc:NP_055423]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--A--A--Q--V--T--L--E--D--A--L--S--N--V--D--L--L--E--E--L--P--L--P--D--Q--Q--P--C--I--E--P--P--P--
ATGGCGGCCCAGGTGACTCTGGAGGACGCGCTGTCCAACGTGGACCTCCTGGAGGAGCTGCCCCTGCCCGACCAGCAGCCCTGCATCGAGCCCCCGCCAT
:::::::::::::::::.::::::::.:: ::::::::.:::::::: :::::.::::::::.::::::::::::::::: ::::::::::::::.::::
ATGGCGGCCCAGGTGACCCTGGAGGATGCTCTGTCCAATGTGGACCTGCTGGAAGAGCTGCCTCTGCCCGACCAGCAGCCATGCATCGAGCCCCCACCAT
-M--A--A--Q--V--T--L--E--D--A--L--S--N--V--D--L--L--E--E--L--P--L--P--D--Q--Q--P--C--I--E--P--P--P--

----------------><----------------------------------------------------------------------------------
S--S--L--L--Y--Q--P--N--F--N--T--N--F--E--D--R--N--A--F--V--T--G--I--A--R--Y--I--E--Q--A--T--V--H--S
CCTCGCTGCTCTACCAGCCAAATTTCAACACTAACTTTGAAGACAGAAATGCATTTGTTACTGGCATCGCAAGATACATTGAACAAGCCACCGTCCACTC
::::.:::::::::::::::::::::::::::::::::::::::::::::::::::::.::.:::::::::::::::::::::::::: ::.:::::.::
CCTCACTGCTCTACCAGCCAAATTTCAACACTAACTTTGAAGACAGAAATGCATTTGTCACCGGCATCGCAAGATACATTGAACAAGCGACTGTCCATTC
S--S--L--L--Y--Q--P--N--F--N--T--N--F--E--D--R--N--A--F--V--T--G--I--A--R--Y--I--E--Q--A--T--V--H--S

------><----------------------------------------------------------------------------><--------------
--S--M--N--E--M--L--E--E--G--Q--E--Y--A--V--M--L--Y--T--W--R--S--C--S--R--A--I--P--Q--V--K--C--N--E-
TAGCATGAACGAGATGCTGGAGGAGGGCCAAGAATATGCTGTCATGCTGTACACCTGGAGGAGCTGCTCCCGGGCCATCCCACAGGTGAAATGTAACGAG
:::::::               .:.::.:::::.::.::::::::::::::::::::::::::::::::.:::::.::::::::::::::.::::::::.
TAGCATG---------------AAAGGTCAAGAGTACGCTGTCATGCTGTACACCTGGAGGAGCTGCTCTCGGGCTATCCCACAGGTGAAGTGTAACGAA
--S--M-----------------K--G--Q--E--Y--A--V--M--L--Y--T--W--R--S--C--S--R--A--I--P--Q--V--K--C--N--E-

--------------------------------------------------------------------------------------><------------
-Q--P--N--R--V--E--I--Y--E--K--T--V--E--V--L--E--P--E--V--T--K--L--M--N--F--M--Y--F--Q--R--N--A--I--
CAGCCTAACAGAGTGGAAATCTACGAGAAAACCGTGGAGGTTCTGGAGCCTGAGGTCACAAAACTGATGAATTTCATGTACTTCCAGAGAAATGCCATTG
:::::.::.:::::::::::.::.::::::::.::::::::::: ::::::::.::::::::::::::::::::.::::::::::::::.::::::::.:
CAGCCCAATAGAGTGGAAATTTATGAGAAAACTGTGGAGGTTCTTGAGCCTGAAGTCACAAAACTGATGAATTTTATGTACTTCCAGAGGAATGCCATCG
-Q--P--N--R--V--E--I--Y--E--K--T--V--E--V--L--E--P--E--V--T--K--L--M--N--F--M--Y--F--Q--R--N--A--I--

----------------------------------------------------------------------------------------------------
E--R--F--C--G--E--V--R--R--L--C--H--A--E--R--R--K--D--F--V--S--E--A--Y--L--I--T--L--G--K--F--I--N--M
AGCGTTTCTGCGGGGAAGTGAGGCGCCTGTGCCATGCCGAGAGGAGGAAGGACTTCGTGTCAGAAGCCTACCTGATCACACTGGGCAAATTCATCAACAT
::::::::::.:::::.:::::::::::::::::.:: :::::.:::::::::::::: :: ::.:::::::::::::: ::::::::.:::::::::::
AGCGTTTCTGTGGGGAGGTGAGGCGCCTGTGCCACGCGGAGAGAAGGAAGGACTTCGTTTCTGAGGCCTACCTGATCACCCTGGGCAAGTTCATCAACAT
E--R--F--C--G--E--V--R--R--L--C--H--A--E--R--R--K--D--F--V--S--E--A--Y--L--I--T--L--G--K--F--I--N--M

--------------------------------------------------------------------><------------------------------
--F--A--V--L--D--E--L--K--N--M--K--C--S--V--K--N--D--H--S--A--Y--K--R--A--A--Q--F--L--R--K--M--A--D-
GTTCGCTGTGCTGGACGAGCTGAAGAACATGAAGTGCAGTGTGAAGAACGACCACTCAGCGTACAAGAGGGCCGCTCAGTTTTTACGTAAAATGGCAGAT
:::.::::::.::::.:::::::::::::::::::::::.::::::::.:::::::: :: ::::::   ::.:::::::::::::::::::::::::::
GTTTGCTGTGTTGGATGAGCTGAAGAACATGAAGTGCAGCGTGAAGAATGACCACTCTGCCTACAAG---GCTGCTCAGTTTTTACGTAAAATGGCAGAT
--F--A--V--L--D--E--L--K--N--M--K--C--S--V--K--N--D--H--S--A--Y--K-----A--A--Q--F--L--R--K--M--A--D-

-----------------------------------------------------------------><---------------------------------
-P--Q--S--I--Q--E--S--Q--N--L--S--M--F--L--A--N--H--N--K--I--T--Q--S--L--Q--Q--Q--L--E--V--I--S--G--
CCACAGTCCATCCAGGAATCGCAGAATCTGTCCATGTTCCTGGCCAATCATAACAAGATCACACAGTCTCTGCAGCAGCAGCTCGAAGTGATTTCTGGCT
::::::::::::::::::::.::::::::.:::::::::::::::::.::.::::::::::::   :::::::::::::::::.::::::::::::::::
CCACAGTCCATCCAGGAATCACAGAATCTATCCATGTTCCTGGCCAACCACAACAAGATCACA---TCTCTGCAGCAGCAGCTTGAAGTGATTTCTGGCT
-P--Q--S--I--Q--E--S--Q--N--L--S--M--F--L--A--N--H--N--K--I--T-----S--L--Q--Q--Q--L--E--V--I--S--G--

----------------------------------------------------------------------------------------------><----
Y--E--E--L--L--A--D--I--V--N--L--C--V--D--Y--Y--E--N--R--M--Y--L--T--P--S--E--K--H--M--L--L--K--V--M
ACGAAGAGCTCCTGGCAGATATTGTGAATCTGTGTGTGGATTACTACGAGAACAGGATGTATTTGACGCCCAGTGAGAAACACATGCTTCTCAAAGTCAT
:.:::::::::.:.:::::.::.::::::.::::::::::::::::.::.::.:::::::::::::::::::::::::::::::::::::::::::::::
ATGAAGAGCTCTTAGCAGACATCGTGAATTTGTGTGTGGATTACTATGAAAATAGGATGTATTTGACGCCCAGTGAGAAACACATGCTTCTCAAAGTCAT
Y--E--E--L--L--A--D--I--V--N--L--C--V--D--Y--Y--E--N--R--M--Y--L--T--P--S--E--K--H--M--L--L--K--V--M

--------------------------------------------------------------------------------------------------->
--G--F--G--L--Y--L--M--D--G--S--V--S--N--I--Y--K--L--D--A--K--K--R--I--N--L--S--K--I--D--K--Y--F--K-
GGGATTTGGTCTGTACCTGATGGATGGGAGTGTCAGTAACATCTATAAGTTGGATGCCAAGAAAAGAATAAACTTATCCAAAATCGACAAGTACTTCAAG
::::::::::::::::.:::::::::::::::::::.:::::.:::::..:.::::::::::::::::::::::::::::::::::::::::::::::::
GGGATTTGGTCTGTACTTGATGGATGGGAGTGTCAGCAACATTTATAAACTAGATGCCAAGAAAAGAATAAACTTATCCAAAATCGACAAGTACTTCAAG
--G--F--G--L--Y--L--M--D--G--S--V--S--N--I--Y--K--L--D--A--K--K--R--I--N--L--S--K--I--D--K--Y--F--K-

<------------------------------------------------------------------------------------------><-------
-Q--L--Q--V--V--P--L--F--G--D--M--Q--I--E--L--A--R--Y--I--K--T--S--A--H--Y--E--E--N--K--S--R--W--T--
CAACTCCAGGTGGTTCCGCTATTTGGGGACATGCAAATAGAACTGGCAAGATATATCAAGACCAGCGCCCACTACGAGGAAAATAAATCTCGATGGACGT
                     ::::::::::::::::::::::::::::::::.::::::::::::::.:::::.:::::::::::::::   :::::::
---------------------TTTGGGGACATGCAAATAGAACTGGCAAGATACATCAAGACCAGCGCTCACTATGAGGAAAATAAATCT---TGGACGT
----------------------F--G--D--M--Q--I--E--L--A--R--Y--I--K--T--S--A--H--Y--E--E--N--K--S-----W--T--

----------------------------------------------------------------------------------------------------
C--T--S--S--G--S--S--P--Q--Y--N--I--C--E--Q--M--I--Q--I--R--E--D--H--M--R--F--I--S--E--L--A--R--Y--S
GCACATCCTCCGGCAGCAGCCCTCAGTACAACATCTGCGAGCAGATGATCCAGATCCGCGAGGACCACATGCGCTTCATTTCGGAGCTGGCGCGCTACAG
::::::::::..:::::::::: ::::::::::::::::::::::::.:::::::::: ::::::::::::::::::::.:::::::::::.:: ::.::
GCACATCCTCTAGCAGCAGCCCACAGTACAACATCTGCGAGCAGATGGTCCAGATCCGAGAGGACCACATGCGCTTCATCTCGGAGCTGGCACGATATAG
C--T--S--S--S--S--S--P--Q--Y--N--I--C--E--Q--M--V--Q--I--R--E--D--H--M--R--F--I--S--E--L--A--R--Y--S

---------><-----------------------------------------------------------------------------------------
--N--S--E--V--V--T--G--S--G--R--Q--E--A--Q--K--T--D--A--E--Y--R--K--L--F--D--L--A--L--Q--G--L--Q--L-
CAACAGCGAGGTGGTCACGGGCTCGGGCCGCCAGGAGGCCCAGAAGACGGACGCGGAGTACCGCAAGCTCTTCGACCTGGCGCTGCAGGGCCTGCAGCTG
::::::::::::::::::.::::::::::::::::::::.::::::::.::::: :::::::: :::::::::::::::::.::::::::::::::::::
CAACAGCGAGGTGGTCACAGGCTCGGGCCGCCAGGAGGCTCAGAAGACAGACGCTGAGTACCGGAAGCTCTTCGACCTGGCACTGCAGGGCCTGCAGCTG
--N--S--E--V--V--T--G--S--G--R--Q--E--A--Q--K--T--D--A--E--Y--R--K--L--F--D--L--A--L--Q--G--L--Q--L-

--------------------------------><------------------------------------------------------------------
-L--S--Q--W--S--A--H--V--M--E--V--Y--S--W--K--L--V--H--P--T--D--K--Y--S--N--K--D--C--P--D--S--A--E--
TTGTCGCAGTGGAGCGCGCACGTGATGGAAGTGTATTCCTGGAAGCTTGTGCACCCCACCGACAAGTACTCCAACAAGGACTGCCCCGACAGCGCTGAAG
.:::::::::::::::: :::::::::::::::::.:: :::::.::::::::::: :: :::::::::::::::::::::::::::::::..:::::.:
CTGTCGCAGTGGAGCGCTCACGTGATGGAAGTGTACTCATGGAAACTTGTGCACCCAACGGACAAGTACTCCAACAAGGACTGCCCCGACAATGCTGAGG
-L--S--Q--W--S--A--H--V--M--E--V--Y--S--W--K--L--V--H--P--T--D--K--Y--S--N--K--D--C--P--D--N--A--E--

----------------------------------------------------------><----------------------------------------
E--Y--E--R--A--T--R--Y--N--Y--T--S--E--E--K--F--A--L--V--E--V--I--A--M--I--K--G--L--Q--V--L--M--G--R
AGTACGAGCGTGCCACGCGCTACAACTACACCAGCGAGGAGAAGTTTGCCCTAGTGGAGGTGATCGCCATGATCAAAGGCCTGCAGGTGCTGATGGGCAG
::::.::::: ::::: :::::::::::::::::.:::::::::               :::::.:::::::::::::::.::::::: :::::::::::
AGTATGAGCGGGCCACCCGCTACAACTACACCAGTGAGGAGAAG---------------GTGATTGCCATGATCAAAGGCTTGCAGGTCCTGATGGGCAG
E--Y--E--R--A--T--R--Y--N--Y--T--S--E--E--K-----------------V--I--A--M--I--K--G--L--Q--V--L--M--G--R

----------------------------------------------------------------------------------------------------
--M--E--S--V--F--N--H--A--I--R--H--T--V--Y--A--A--L--Q--D--F--S--Q--V--T--L--R--E--P--L--R--Q--A--I-
GATGGAGAGCGTGTTCAACCACGCCATCCGGCACACCGTCTATGCCGCACTGCAGGACTTCTCCCAGGTGACCCTTAGGGAGCCGCTGCGGCAGGCCATC
:::::::::::::::::::::.:::::::: :::::::::::.::.::::::::::::::::::::::: :::::.:::::::::::  ::::.::::::
GATGGAGAGCGTGTTCAACCATGCCATCCGCCACACCGTCTACGCTGCACTGCAGGACTTCTCCCAGGTCACCCTCAGGGAGCCGCTCAGGCAAGCCATC
--M--E--S--V--F--N--H--A--I--R--H--T--V--Y--A--A--L--Q--D--F--S--Q--V--T--L--R--E--P--L--R--Q--A--I-

-------------------------><-------------------------------------------------------------------------
-K--K--K--K--N--V--I--Q--S--V--L--Q--A--I--R--K--T--V--C--D--W--E--T--G--H--E--P--F--N--D--P--A--L--
AAGAAGAAGAAGAACGTCATCCAGAGTGTCCTGCAGGCCATCAGGAAGACCGTGTGTGACTGGGAGACGGGGCATGAGCCCTTCAATGACCCAGCCTTGC
:::::::::::::::::.::::::   :::::::::::::::::::::::::::::::::::::::::.:::::.::.:::::::::::::: :::.: :
AAGAAGAAGAAGAACGTTATCCAG---GTCCTGCAGGCCATCAGGAAGACCGTGTGTGACTGGGAGACAGGGCACGAACCCTTCAATGACCCTGCCCTTC
-K--K--K--K--N--V--I--Q-----V--L--Q--A--I--R--K--T--V--C--D--W--E--T--G--H--E--P--F--N--D--P--A--L--

-------------------------------------------------------------------------><-------------------------
R--G--E--K--D--P--K--S--G--F--D--I--K--V--P--R--R--A--V--G--P--S--S--T--Q--L--Y--M--V--R--T--M--L--E
GGGGCGAGAAGGACCCCAAGAGCGGCTTCGACATAAAAGTACCACGCCGCGCCGTGGGACCCTCCAGCACTCAGCTTTACATGGTGAGAACCATGCTAGA
::::.:::::::::::::::::.::::::::::: :::::.:: :: :::::::::::::::::.:::::.:::::::::::::::::::::::::::::
GGGGTGAGAAGGACCCCAAGAGTGGCTTCGACATTAAAGTGCCTCGGCGCGCCGTGGGACCCTCTAGCACCCAGCTTTACATGGTGAGAACCATGCTAGA
R--G--E--K--D--P--K--S--G--F--D--I--K--V--P--R--R--A--V--G--P--S--S--T--Q--L--Y--M--V--R--T--M--L--E

----------------------------------------------------------------------------------------------------
--S--L--I--A--D--K--S--G--S--K--K--T--L--R--S--S--L--E--G--P--T--I--L--D--I--E--K--F--H--R--E--S--F-
GTCCCTCATTGCAGACAAAAGTGGTTCCAAGAAAACCTTGAGAAGTAGCCTTGAGGGGCCCACCATATTGGACATAGAAAAATTTCATCGAGAGTCATTC
:::::::::::::::::::::::::::::::::::::.::::.:::::::::::::::::::::::::::::::: :::::::::::::: :::::::::
GTCCCTCATTGCAGACAAAAGTGGTTCCAAGAAAACCCTGAGGAGTAGCCTTGAGGGGCCCACCATATTGGACATTGAAAAATTTCATCGCGAGTCATTC
--S--L--I--A--D--K--S--G--S--K--K--T--L--R--S--S--L--E--G--P--T--I--L--D--I--E--K--F--H--R--E--S--F-

---------------------------><-----------------------------------------------------------------------
-F--Y--T--H--L--I--N--F--S--E--T--L--Q--Q--C--C--D--L--S--Q--L--W--F--R--E--F--F--L--E--L--T--M--G--
TTCTACACTCACTTGATAAATTTCAGTGAAACGCTGCAGCAGTGCTGTGACCTTTCGCAGCTGTGGTTCCGAGAGTTCTTCCTGGAGCTGACCATGGGCA
::::::::.::::::::::::::::::   ::::: ::::::::::::::::::::.:::.:::::::::::::::::::::::::::::::::::::.:
TTCTACACCCACTTGATAAATTTCAGT---ACGCTCCAGCAGTGCTGTGACCTTTCACAGTTGTGGTTCCGAGAGTTCTTCCTGGAGCTGACCATGGGTA
-F--Y--T--H--L--I--N--F--S-----T--L--Q--Q--C--C--D--L--S--Q--L--W--F--R--E--F--F--L--E--L--T--M--G--

------------------------------------------------------------------------------------><--------------
R--R--I--Q--F--P--I--E--M--S--M--P--W--I--L--T--D--H--I--L--E--T--K--E--A--S--M--M--E--Y--V--L--Y--S
GGAGGATCCAGTTCCCCATTGAGATGTCGATGCCCTGGATCCTGACGGACCACATCCTGGAGACCAAGGAGGCATCGATGATGGAGTACGTGCTCTACTC
:.:::::::::::::::::::::::::: :::::::::::::::::.:::::.::::::::::::::::::::::::::::::   ::::: ::::::::
GAAGGATCCAGTTCCCCATTGAGATGTCCATGCCCTGGATCCTGACAGACCATATCCTGGAGACCAAGGAGGCATCGATGATG---TACGTCCTCTACTC
R--R--I--Q--F--P--I--E--M--S--M--P--W--I--L--T--D--H--I--L--E--T--K--E--A--S--M--M-----Y--V--L--Y--S

---------------------------------------------------------------------------------><-----------------
--L--D--L--Y--N--D--S--A--H--Y--A--L--T--R--F--N--K--Q--F--L--Y--D--E--I--E--A--E--V--N--L--C--F--D-
CCTGGACCTGTACAATGACAGCGCCCACTACGCGCTCACCAGGTTCAACAAGCAGTTCCTGTACGACGAAATTGAGGCCGAGGTGAATCTATGTTTTGAC
 :::::::::::::::::.::.::::::::::: :::::::::::::::::::::::.:: :::::.:::::.::::: ::::::::::::::.::::::
ACTGGACCTGTACAATGATAGTGCCCACTACGCCCTCACCAGGTTCAACAAGCAGTTTCTCTACGATGAAATCGAGGCAGAGGTGAATCTATGCTTTGAC
--L--D--L--Y--N--D--S--A--H--Y--A--L--T--R--F--N--K--Q--F--L--Y--D--E--I--E--A--E--V--N--L--C--F--D-

----------------------------------------------------------><----------------------------------------
-Q--F--V--Y--K--L--A--D--Q--I--F--A--Y--Y--K--V--M--A--G--S--L--L--L--D--K--R--L--R--S--E--C--K--N--
CAATTTGTTTACAAGCTAGCAGACCAGATATTTGCCTATTATAAGGTTATGGCAGGAAGTTTGCTTCTTGATAAACGGTTACGATCAGAATGCAAGAATC
:::::::::::.:::::.::::::::::::::::: :::::::::::::::::.:::   :::::::::::::::::::::::::::::.::::::::::
CAATTTGTTTATAAGCTGGCAGACCAGATATTTGCGTATTATAAGGTTATGGCGGGA---TTGCTTCTTGATAAACGGTTACGATCAGAGTGCAAGAATC
-Q--F--V--Y--K--L--A--D--Q--I--F--A--Y--Y--K--V--M--A--G-----L--L--L--D--K--R--L--R--S--E--C--K--N--

-------------------------------------------------------------------><-------------------------------
Q--G--A--T--I--H--L--P--P--S--N--R--Y--E--T--L--L--K--Q--R--H--V--Q--L--L--G--R--S--I--D--L--N--R--L
AGGGAGCCACGATCCACCTCCCGCCGTCTAACCGCTACGAGACGCTGCTGAAGCAGAGGCATGTGCAGCTCCTCGGCAGATCAATAGACCTCAATCGTCT
::::::: ::.::::::::::: ::.:::::::::::.::::::::::: :::::::::::.                                      
AGGGAGCAACAATCCACCTCCCTCCATCTAACCGCTATGAGACGCTGCTCAAGCAGAGGCAC--------------------------------------
Q--G--A--T--I--H--L--P--P--S--N--R--Y--E--T--L--L--K--Q--R--H---------------------------------------

---------------------------------------------------------------------------------------><-----------
--I--T--Q--R--V--S--A--A--M--Y--K--S--L--E--L--A--I--G--R--F--E--S--E--D--L--T--S--I--V--E--L--D--G-
GATCACCCAGCGCGTCTCAGCAGCCATGTATAAGTCCCTAGAACTGGCGATTGGACGATTTGAAAGTGAAGATTTGACCTCCATAGTTGAGCTGGATGGC
                                                                                        ::::::::.:::
----------------------------------------------------------------------------------------GAGCTGGACGGC
-----------------------------------------------------------------------------------------E--L--D--G-

----------------------------------------------------------------------------------------------------
-L--L--E--I--N--R--M--T--H--K--L--L--S--R--Y--L--T--L--D--G--F--D--A--M--F--R--E--A--N--H--N--V--S--
CTGTTGGAAATCAACCGCATGACCCACAAGCTGCTGAGCCGGTACCTGACGCTGGACGGCTTCGACGCCATGTTCCGGGAGGCCAACCACAACGTGTCAG
:: :::::::::::::::::::::::::::::::::::: :::::::::: ::::::.:::::::.::::::::::::::::::::::::::::::::.:
CTCTTGGAAATCAACCGCATGACCCACAAGCTGCTGAGCAGGTACCTGACTCTGGACAGCTTCGATGCCATGTTCCGGGAGGCCAACCACAACGTGTCGG
-L--L--E--I--N--R--M--T--H--K--L--L--S--R--Y--L--T--L--D--S--F--D--A--M--F--R--E--A--N--H--N--V--S--

---------------------------------------------------------------------------------------><-----------
A--P--Y--G--R--I--T--L--H--V--F--W--E--L--N--Y--D--F--L--P--N--Y--C--Y--N--G--S--T--N--R--F--V--R--T
CGCCCTACGGGAGGATCACCCTGCACGTCTTCTGGGAGCTCAACTATGACTTCCTGCCCAACTACTGCTACAACGGCTCTACCAACCGGTTTGTTCGGAC
:.:::::.:::::::::::.:: :::::::::::::::::::::::.::::::::::::::::::::::::::.:::::.:::                 
CACCCTATGGGAGGATCACTCTCCACGTCTTCTGGGAGCTCAACTACGACTTCCTGCCCAACTACTGCTACAATGGCTCCACC-----------------
A--P--Y--G--R--I--T--L--H--V--F--W--E--L--N--Y--D--F--L--P--N--Y--C--Y--N--G--S--T------------------

---------------------------------------------------------------------------><-----------------------
--V--L--P--F--S--Q--E--F--Q--R--D--K--Q--P--N--A--Q--P--Q--Y--L--H--G--S--K--A--L--N--L--A--Y--S--S-
AGTGTTACCATTTTCTCAGGAATTTCAAAGAGATAAGCAGCCTAATGCACAGCCTCAGTATCTGCATGGATCCAAGGCTTTGAACTTGGCCTACTCCAGC
                                                                            :::::.:::.:::::::.:: :::
----------------------------------------------------------------------------GCTTTAAACCTGGCCTATTCGAGC
-----------------------------------------------------------------------------A--L--N--L--A--Y--S--S-

----------------------------------------------------------------------------------------------------
-I--Y--G--S--Y--R--N--F--V--G--P--P--H--F--Q--V--I--C--R--L--L--G--Y--Q--G--I--A--V--V--M--E--E--L--
ATTTACGGCAGCTACCGGAACTTCGTGGGACCTCCACACTTTCAAGTCATCTGCCGGCTTCTCGGCTACCAGGGTATCGCCGTGGTCATGGAGGAGCTGC
::.::.::::::::::::::::::::::: ::.:: :::::.::.:::::::::::::: ::.:::::::::::.::::: :::::::::::.:::::::
ATCTATGGCAGCTACCGGAACTTCGTGGGCCCCCCCCACTTCCAGGTCATCTGCCGGCTGCTTGGCTACCAGGGCATCGCAGTGGTCATGGAAGAGCTGC
-I--Y--G--S--Y--R--N--F--V--G--P--P--H--F--Q--V--I--C--R--L--L--G--Y--Q--G--I--A--V--V--M--E--E--L--

-------------------><-------------------------------------------------------------------------------
L--K--V--V--K--S--L--L--Q--G--T--I--L--Q--Y--V--K--T--L--M--E--V--M--P--K--I--C--R--L--P--R--H--E--Y
TGAAGGTCGTCAAGAGCCTGCTGCAAGGCACAATCCTGCAGTACGTGAAGACGCTGATGGAGGTGATGCCCAAGATCTGCCGCCTGCCCCGGCACGAGTA
::::::: ::.:::::::::::::::::::: ::::::::::::::::::::::::::::::::::::::::::.::::::: ::::: :::::::::::
TGAAGGTGGTTAAGAGCCTGCTGCAAGGCACCATCCTGCAGTACGTGAAGACGCTGATGGAGGTGATGCCCAAGGTCTGCCGGCTGCCGCGGCACGAGTA
L--K--V--V--K--S--L--L--Q--G--T--I--L--Q--Y--V--K--T--L--M--E--V--M--P--K--V--C--R--L--P--R--H--E--Y

----------><----------------------------------------------------------------------------------------
--G--S--P--G--I--L--E--F--F--H--H--Q--L--K--D--I--V--E--Y--A--E--L--K--T--V--C--F--Q--N--L--R--E--V-
CGGCTCTCCTGGTATCCTGGAGTTCTTCCACCACCAGCTGAAGGACATCGTGGAGTACGCAGAGCTGAAGACGGTGTGCTTCCAGAACCTGCGGGAGGTG
::::::.:::   :::::::::::::::::::::::::::::::::::::::::::::::.::::::::::: :::::::::::::::::::::::::::
CGGCTCCCCT---ATCCTGGAGTTCTTCCACCACCAGCTGAAGGACATCGTGGAGTACGCGGAGCTGAAGACCGTGTGCTTCCAGAACCTGCGGGAGGTG
--G--S--P-----I--L--E--F--F--H--H--Q--L--K--D--I--V--E--Y--A--E--L--K--T--V--C--F--Q--N--L--R--E--V-

-----------------------------------------><---------------------------------------------------------
-G--N--A--I--L--F--C--L--L--I--E--Q--S--L--S--L--E--E--V--C--D--L--L--H--A--A--P--F--Q--N--I--L--P--
GGGAACGCCATCCTCTTCTGCCTGCTCATCGAGCAGAGCCTGTCTTTAGAAGAAGTGTGTGACCTGCTGCACGCGGCTCCTTTCCAGAACATCTTGCCGC
:: ::.:::.:::::::::::::::::::::::::::::::::::::.:::::::::::::::::::::::.::.::.:: ::::::::::: :::::: 
GGCAATGCCGTCCTCTTCTGCCTGCTCATCGAGCAGAGCCTGTCTTTGGAAGAAGTGTGTGACCTGCTGCATGCAGCCCCGTTCCAGAACATATTGCCGA
-G--N--A--V--L--F--C--L--L--I--E--Q--S--L--S--L--E--E--V--C--D--L--L--H--A--A--P--F--Q--N--I--L--P--

--------------><------------------------------------------------------------------------------------
R--V--H--V--K--E--G--E--R--L--D--A--K--M--K--R--L--E--S--K--Y--A--P--L--H--L--V--P--L--I--E--R--L--G
GAGTCCATGTGAAAGAGGGGGAGAGACTTGATGCCAAAATGAAAAGACTAGAATCAAAGTACGCCCCGCTGCATCTTGTCCCACTGATTGAAAGACTGGG
:::::::.::::::   ::.:::::::::::::::::::::::::::::::::::::::::::::::.:: ::::::::::: :::::::::::::::::
GAGTCCACGTGAAA---GGAGAGAGACTTGATGCCAAAATGAAAAGACTAGAATCAAAGTACGCCCCACTTCATCTTGTCCCTCTGATTGAAAGACTGGG
R--V--H--V--K-----G--E--R--L--D--A--K--M--K--R--L--E--S--K--Y--A--P--L--H--L--V--P--L--I--E--R--L--G

---------><-----------------------------------------------------------------------------------------
--T--P--Q--Q--I--A--I--A--R--E--G--D--L--L--T--K--E--R--L--C--C--G--L--S--M--F--E--V--I--L--T--R--I-
GACCCCTCAGCAAATTGCCATCGCAAGAGAGGGGGACCTGCTGACAAAGGAGCGCCTCTGCTGCGGCCTGTCCATGTTTGAGGTCATCCTGACACGGATC
.::::::::::::::::: :: ::.:::::::::::::::::::::::::::::.::::::::.:::::::::::::::::.::::::::::: ::::::
AACCCCTCAGCAAATTGCAATAGCGAGAGAGGGGGACCTGCTGACAAAGGAGCGTCTCTGCTGTGGCCTGTCCATGTTTGAAGTCATCCTGACTCGGATC
--T--P--Q--Q--I--A--I--A--R--E--G--D--L--L--T--K--E--R--L--C--C--G--L--S--M--F--E--V--I--L--T--R--I-

----------------------------------------------------------------------------------------------------
-R--S--F--L--D--D--P--I--W--R--G--P--L--P--S--N--G--V--M--H--V--D--E--C--V--E--F--H--R--L--W--S--A--
CGGAGCTTTCTGGATGACCCCATCTGGCGCGGGCCTCTGCCCAGCAATGGGGTCATGCATGTGGACGAGTGTGTGGAGTTTCACAGACTGTGGAGTGCCA
:::: ::::::::::::::::::::::::::::::::::::::::::.:::::::::::.:::::.:: ::.:: :::::::::::.::::::::.::::
CGGACCTTTCTGGATGACCCCATCTGGCGCGGGCCTCTGCCCAGCAACGGGGTCATGCACGTGGATGACTGCGTCGAGTTTCACAGGCTGTGGAGCGCCA
-R--T--F--L--D--D--P--I--W--R--G--P--L--P--S--N--G--V--M--H--V--D--D--C--V--E--F--H--R--L--W--S--A--

------------------------------------------------><--------------------------------------------------
M--Q--F--V--Y--C--I--P--V--G--T--H--E--F--T--V--E--Q--C--F--G--D--G--L--H--W--A--G--C--M--I--I--V--L
TGCAGTTTGTCTACTGCATTCCCGTGGGGACACACGAGTTCACAGTCGAGCAGTGCTTTGGTGATGGGCTACACTGGGCTGGCTGTATGATCATCGTACT
::::::::::::::::::::::::::::::::::.:::::.::.:::   :::::.:::::.::.::::: ::::::::::::::.:::::::::::.::
TGCAGTTTGTCTACTGCATTCCCGTGGGGACACATGAGTTTACGGTC---CAGTGTTTTGGCGACGGGCTCCACTGGGCTGGCTGCATGATCATCGTGCT
M--Q--F--V--Y--C--I--P--V--G--T--H--E--F--T--V-----Q--C--F--G--D--G--L--H--W--A--G--C--M--I--I--V--L

------------------------------------------------------------------------------------------------><--
--L--G--Q--Q--R--R--F--A--V--L--D--F--C--Y--H--L--L--K--V--Q--K--H--D--G--K--D--E--I--I--K--N--V--P-
TCTTGGGCAGCAGCGGCGTTTTGCTGTGCTGGATTTCTGCTACCATCTACTTAAAGTCCAGAAACATGATGGCAAAGATGAGATTATTAAAAATGTGCCT
::: ::::::::::::::.::::::::.::::::::.:::::.::::: ::.:::::::::::::::::::::::::::::.:::::.::::::::::::
TCTGGGGCAGCAGCGGCGCTTTGCTGTACTGGATTTTTGCTATCATCTCCTCAAAGTCCAGAAACATGATGGCAAAGATGAAATTATCAAAAATGTGCCT
--L--G--Q--Q--R--R--F--A--V--L--D--F--C--Y--H--L--L--K--V--Q--K--H--D--G--K--D--E--I--I--K--N--V--P-

----------------------------------------------------------------------------------------------------
-L--K--K--M--V--E--R--I--R--K--F--Q--I--L--N--D--E--I--I--T--I--L--D--K--Y--L--K--S--G--D--G--E--G--
TTGAAGAAGATGGTGGAGAGAATTCGCAAGTTCCAGATTCTCAATGATGAGATCATCACCATCCTGGATAAGTACCTGAAGTCAGGCGACGGGGAGGGCA
:::::::::::::::::::::::::: :::::::::::::::::::::::::: :::::.:::.::::.::::::.:::::::.::::::::.:::.:::
TTGAAGAAGATGGTGGAGAGAATTCGGAAGTTCCAGATTCTCAATGATGAGATAATCACTATCTTGGACAAGTACTTGAAGTCGGGCGACGGAGAGAGCA
-L--K--K--M--V--E--R--I--R--K--F--Q--I--L--N--D--E--I--I--T--I--L--D--K--Y--L--K--S--G--D--G--E--S--

------------------------------------------------------------->
T--P--V--E--H--V--R--C--F--Q--P--P--I--H--Q--S--L--A--S--S--*-
CGCCAGTGGAGCATGTGCGCTGCTTCCAGCCGCCCATCCACCAGTCCCTCGCCAGCAGCTGA
:::: ::::::::.:: ::::::::.:::::.::.::.:::::.::::: ::::::::::::
CGCCTGTGGAGCACGTTCGCTGCTTTCAGCCACCTATTCACCAATCCCTGGCCAGCAGCTGA
T--P--V--E--H--V--R--C--F--Q--P--P--I--H--Q--S--L--A--S--S--*-

Pig Consensus Sequence

>BGISUST0000899446
ATGGCGGCCCAGGTGACCCTGGAGGATGCTCTGTCCAATGTGGACCTGCTGGAAGAGCTGCCTCTGCCCGACCAGCAGCCATGCATCGAGCCCCCACCAT
CCTCACTGCTCTACCAGCCAAATTTCAACACTAACTTTGAAGACAGAAATGCATTTGTCACCGGCATCGCAAGATACATTGAACAAGCGACTGTCCATTC
TAGCATG---------------AAAGGTCAAGAGTACGCTGTCATGCTGTACACCTGGAGGAGCTGCTCTCGGGCTATCCCACAGGTGAAGTGTAACGAA
CAGCCCAATAGAGTGGAAATTTATGAGAAAACTGTGGAGGTTCTTGAGCCTGAAGTCACAAAACTGATGAATTTTATGTACTTCCAGAGGAATGCCATCG
AGCGTTTCTGTGGGGAGGTGAGGCGCCTGTGCCACGCGGAGAGAAGGAAGGACTTCGTTTCTGAGGCCTACCTGATCACCCTGGGCAAGTTCATCAACAT
GTTTGCTGTGTTGGATGAGCTGAAGAACATGAAGTGCAGCGTGAAGAATGACCACTCTGCCTACAAG---GCTGCTCAGTTTTTACGTAAAATGGCAGAT
CCACAGTCCATCCAGGAATCACAGAATCTATCCATGTTCCTGGCCAACCACAACAAGATCACA---TCTCTGCAGCAGCAGCTTGAAGTGATTTCTGGCT
ATGAAGAGCTCTTAGCAGACATCGTGAATTTGTGTGTGGATTACTATGAAAATAGGATGTATTTGACGCCCAGTGAGAAACACATGCTTCTCAAAGTCAT
GGGATTTGGTCTGTACTTGATGGATGGGAGTGTCAGCAACATTTATAAACTAGATGCCAAGAAAAGAATAAACTTATCCAAAATCGACAAGTACTTCAAG
---------------------TTTGGGGACATGCAAATAGAACTGGCAAGATACATCAAGACCAGCGCTCACTATGAGGAAAATAAATCT---TGGACGT
GCACATCCTCTAGCAGCAGCCCACAGTACAACATCTGCGAGCAGATGGTCCAGATCCGAGAGGACCACATGCGCTTCATCTCGGAGCTGGCACGATATAG
CAACAGCGAGGTGGTCACAGGCTCGGGCCGCCAGGAGGCTCAGAAGACAGACGCTGAGTACCGGAAGCTCTTCGACCTGGCACTGCAGGGCCTGCAGCTG
CTGTCGCAGTGGAGCGCTCACGTGATGGAAGTGTACTCATGGAAACTTGTGCACCCAACGGACAAGTACTCCAACAAGGACTGCCCCGACAATGCTGAGG
AGTATGAGCGGGCCACCCGCTACAACTACACCAGTGAGGAGAAG---------------GTGATTGCCATGATCAAAGGCTTGCAGGTCCTGATGGGCAG
GATGGAGAGCGTGTTCAACCATGCCATCCGCCACACCGTCTACGCTGCACTGCAGGACTTCTCCCAGGTCACCCTCAGGGAGCCGCTCAGGCAAGCCATC
AAGAAGAAGAAGAACGTTATCCAG---GTCCTGCAGGCCATCAGGAAGACCGTGTGTGACTGGGAGACAGGGCACGAACCCTTCAATGACCCTGCCCTTC
GGGGTGAGAAGGACCCCAAGAGTGGCTTCGACATTAAAGTGCCTCGGCGCGCCGTGGGACCCTCTAGCACCCAGCTTTACATGGTGAGAACCATGCTAGA
GTCCCTCATTGCAGACAAAAGTGGTTCCAAGAAAACCCTGAGGAGTAGCCTTGAGGGGCCCACCATATTGGACATTGAAAAATTTCATCGCGAGTCATTC
TTCTACACCCACTTGATAAATTTCAGT---ACGCTCCAGCAGTGCTGTGACCTTTCACAGTTGTGGTTCCGAGAGTTCTTCCTGGAGCTGACCATGGGTA
GAAGGATCCAGTTCCCCATTGAGATGTCCATGCCCTGGATCCTGACAGACCATATCCTGGAGACCAAGGAGGCATCGATGATG---TACGTCCTCTACTC
ACTGGACCTGTACAATGATAGTGCCCACTACGCCCTCACCAGGTTCAACAAGCAGTTTCTCTACGATGAAATCGAGGCAGAGGTGAATCTATGCTTTGAC
CAATTTGTTTATAAGCTGGCAGACCAGATATTTGCGTATTATAAGGTTATGGCGGGA---TTGCTTCTTGATAAACGGTTACGATCAGAGTGCAAGAATC
AGGGAGCAACAATCCACCTCCCTCCATCTAACCGCTATGAGACGCTGCTCAAGCAGAGGCAC--------------------------------------
----------------------------------------------------------------------------------------GAGCTGGACGGC
CTCTTGGAAATCAACCGCATGACCCACAAGCTGCTGAGCAGGTACCTGACTCTGGACAGCTTCGATGCCATGTTCCGGGAGGCCAACCACAACGTGTCGG
CACCCTATGGGAGGATCACTCTCCACGTCTTCTGGGAGCTCAACTACGACTTCCTGCCCAACTACTGCTACAATGGCTCCACC-----------------
----------------------------------------------------------------------------GCTTTAAACCTGGCCTATTCGAGC
ATCTATGGCAGCTACCGGAACTTCGTGGGCCCCCCCCACTTCCAGGTCATCTGCCGGCTGCTTGGCTACCAGGGCATCGCAGTGGTCATGGAAGAGCTGC
TGAAGGTGGTTAAGAGCCTGCTGCAAGGCACCATCCTGCAGTACGTGAAGACGCTGATGGAGGTGATGCCCAAGGTCTGCCGGCTGCCGCGGCACGAGTA
CGGCTCCCCT---ATCCTGGAGTTCTTCCACCACCAGCTGAAGGACATCGTGGAGTACGCGGAGCTGAAGACCGTGTGCTTCCAGAACCTGCGGGAGGTG
GGCAATGCCGTCCTCTTCTGCCTGCTCATCGAGCAGAGCCTGTCTTTGGAAGAAGTGTGTGACCTGCTGCATGCAGCCCCGTTCCAGAACATATTGCCGA
GAGTCCACGTGAAA---GGAGAGAGACTTGATGCCAAAATGAAAAGACTAGAATCAAAGTACGCCCCACTTCATCTTGTCCCTCTGATTGAAAGACTGGG
AACCCCTCAGCAAATTGCAATAGCGAGAGAGGGGGACCTGCTGACAAAGGAGCGTCTCTGCTGTGGCCTGTCCATGTTTGAAGTCATCCTGACTCGGATC
CGGACCTTTCTGGATGACCCCATCTGGCGCGGGCCTCTGCCCAGCAACGGGGTCATGCACGTGGATGACTGCGTCGAGTTTCACAGGCTGTGGAGCGCCA
TGCAGTTTGTCTACTGCATTCCCGTGGGGACACATGAGTTTACGGTC---CAGTGTTTTGGCGACGGGCTCCACTGGGCTGGCTGCATGATCATCGTGCT
TCTGGGGCAGCAGCGGCGCTTTGCTGTACTGGATTTTTGCTATCATCTCCTCAAAGTCCAGAAACATGATGGCAAAGATGAAATTATCAAAAATGTGCCT
TTGAAGAAGATGGTGGAGAGAATTCGGAAGTTCCAGATTCTCAATGATGAGATAATCACTATCTTGGACAAGTACTTGAAGTCGGGCGACGGAGAGAGCA
CGCCTGTGGAGCACGTTCGCTGCTTTCAGCCACCTATTCACCAATCCCTGGCCAGCAGCTGA


>BGISUSP0000899446
MAAQVTLEDALSNVDLLEELPLPDQQPCIEPPPSSLLYQPNFNTNFEDRNAFVTGIARYIEQATVHSSM-----KGQEYAVMLYTWRSCSRAIPQVKCNE
QPNRVEIYEKTVEVLEPEVTKLMNFMYFQRNAIERFCGEVRRLCHAERRKDFVSEAYLITLGKFINMFAVLDELKNMKCSVKNDHSAYK-AAQFLRKMAD
PQSIQESQNLSMFLANHNKIT-SLQQQLEVISGYEELLADIVNLCVDYYENRMYLTPSEKHMLLKVMGFGLYLMDGSVSNIYKLDAKKRINLSKIDKYFK
-------FGDMQIELARYIKTSAHYEENKS-WTCTSSSSSPQYNICEQMVQIREDHMRFISELARYSNSEVVTGSGRQEAQKTDAEYRKLFDLALQGLQL
LSQWSAHVMEVYSWKLVHPTDKYSNKDCPDNAEEYERATRYNYTSEEK-----VIAMIKGLQVLMGRMESVFNHAIRHTVYAALQDFSQVTLREPLRQAI
KKKKNVIQ-VLQAIRKTVCDWETGHEPFNDPALRGEKDPKSGFDIKVPRRAVGPSSTQLYMVRTMLESLIADKSGSKKTLRSSLEGPTILDIEKFHRESF
FYTHLINFS-TLQQCCDLSQLWFREFFLELTMGRRIQFPIEMSMPWILTDHILETKEASMM-YVLYSLDLYNDSAHYALTRFNKQFLYDEIEAEVNLCFD
QFVYKLADQIFAYYKVMAG-LLLDKRLRSECKNQGATIHLPPSNRYETLLKQRH------------------------------------------ELDG
LLEINRMTHKLLSRYLTLDSFDAMFREANHNVSAPYGRITLHVFWELNYDFLPNYCYNGST-------------------------------ALNLAYSS
IYGSYRNFVGPPHFQVICRLLGYQGIAVVMEELLKVVKSLLQGTILQYVKTLMEVMPKVCRLPRHEYGSP-ILEFFHHQLKDIVEYAELKTVCFQNLREV
GNAVLFCLLIEQSLSLEEVCDLLHAAPFQNILPRVHVK-GERLDAKMKRLESKYAPLHLVPLIERLGTPQQIAIAREGDLLTKERLCCGLSMFEVILTRI
RTFLDDPIWRGPLPSNGVMHVDDCVEFHRLWSAMQFVYCIPVGTHEFTV-QCFGDGLHWAGCMIIVLLGQQRRFAVLDFCYHLLKVQKHDGKDEIIKNVP
LKKMVERIRKFQILNDEIITILDKYLKSGDGESTPVEHVRCFQPPIHQSLASS*