Sequences
EST Library Info
fat1Fatt
Clusters
Oligos
SNPs

Gene ID ENSG00000149582 (click for geneview)
Transcript ID ENST00000313236(link to ensembl)
Symbol TMM25_HUMAN
Localtion Chromosome:11:117907127:117911753:1 band: 11q23.3
Description Transmembrane protein 25 precursor (UNQ2531/PRO6030).
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<--------------------------------------------------------------------><-----------------------------
-M--A--L--P--P--G--P--A--A--L--R--H--T--L--L--L--L--P--A--L--L--S--S--G--W--G--E--L--E--P--Q--I--D--
ATGGCGCTGCCTCCAGGCCCAGCCGCCCTCCGGCACACACTGCTGCTCCTGCCAGCCCTTCTGAGCTCAGGTTGGGGGGAGTTGGAGCCACAAATAGATG
::::::::::.::: :: ::::: .:::::: ::::::::::::::::::::::::::::::::::      ::::::::::::: ::::::::: ::::
ATGGCGCTGCTTCCCGGGCCAGCAACCCTCCCGCACACACTGCTGCTCCTGCCAGCCCTTCTGAGC------TGGGGGGAGTTGGCGCCACAAATTGATG
-M--A--L--L--P--G--P--A--T--L--P--H--T--L--L--L--L--P--A--L--L--S--------W--G--E--L--A--P--Q--I--D--

----------------------------------------------------------------------------------------------------
G--Q--T--W--A--E--R--A--L--R--E--N--E--R--H--A--F--T--C--R--V--A--G--G--P--G--T--P--R--L--A--W--Y--L
GTCAGACCTGGGCTGAGCGGGCACTTCGGGAGAATGAACGCCACGCCTTCACCTGCCGGGTGGCAGGGGGGCCTGGCACCCCCAGATTGGCCTGGTATCT
::::::::::::::::::::::::::::.::::::::::::::.:::::::::::::::::::::::::::::::  :::::: :::::::::::::.::
GTCAGACCTGGGCTGAGCGGGCACTTCGAGAGAATGAACGCCATGCCTTCACCTGCCGGGTGGCAGGGGGGCCTGC-ACCCCCCGATTGGCCTGGTACCT
G--Q--T--W--A--E--R--A--L--R--E--N--E--R--H--A--F--T--C--R--V--A--G--G--P--G--T--P--R--L--A--W--Y--L

----------------------------------------------------------------------------------------------------
--D--G--Q--L--Q--E--A--S--T--S--R--L--L--S--V--G--G--E--A--F--S--G--G--T--S--T--F--T--V--T--A--H--R-
GGATGGACAGCTGCAGGAGGCCAGCACCTCAAGACTGCTGAGCGTGGGAGGGGAGGCCTTCTCTGGAGGCACCAGCACCTTCACTGTCACTGCCCATCGG
::::::::::::.:::::::::::: ::::.:::::.::::::::::: :::.::::::::::.::::::::::::::.:::::::::::::::::  ::
GGATGGACAGCTACAGGAGGCCAGCTCCTCGAGACTACTGAGCGTGGGTGGGAAGGCCTTCTCCGGAGGCACCAGCACTTTCACTGTCACTGCCCAGAGG
--D--G--Q--L--Q--E--A--S--S--S--R--L--L--S--V--G--G--K--A--F--S--G--G--T--S--T--F--T--V--T--A--Q--R-

------------------------------------------------------------------------------------><--------------
-A--Q--H--E--L--N--C--S--L--Q--D--P--R--S--G--R--S--A--N--A--S--V--I--L--N--V--Q--F--K--P--E--I--A--
GCCCAGCATGAGCTCAACTGCTCTCTGCAGGACCCCAGAAGTGGCCGATCAGCCAACGCCTCTGTCATCCTTAATGTGCAATTCAAGCCAGAGATTGCCC
::.::::::::::::::::::::.::::::::::: :: ::::::::.:::::::::::.::.::::::::.:::::.:::   :::::.::::::::::
GCTCAGCATGAGCTCAACTGCTCCCTGCAGGACCCAAGCAGTGGCCGGTCAGCCAACGCTTCCGTCATCCTCAATGTACAA---AAGCCGGAGATTGCCC
-A--Q--H--E--L--N--C--S--L--Q--D--P--S--S--G--R--S--A--N--A--S--V--I--L--N--V--Q-----K--P--E--I--A--

----------------------------------------------------------------------------------------------------
Q--V--G--A--K--Y--Q--E--A--Q--G--P--G--L--L--V--V--L--F--A--L--V--R--A--N--P--P--A--N--V--T--W--I--D
AAGTCGGCGCCAAGTACCAGGAAGCTCAGGGCCCAGGCCTCCTGGTTGTCCTGTTTGCCCTGGTGCGTGCCAACCCGCCGGCCAATGTCACCTGGATCGA
:.: .:: :::::::::::.::::::::::::::::::::::::::.:: :: :::::::::::::::::::::::::: :::::::: :::::::::::
AGGGTGGGGCCAAGTACCAAGAAGCTCAGGGCCCAGGCCTCCTGGTCGTACTTTTTGCCCTGGTGCGTGCCAACCCGCCTGCCAATGTGACCTGGATCGA
Q--G--G--A--K--Y--Q--E--A--Q--G--P--G--L--L--V--V--L--F--A--L--V--R--A--N--P--P--A--N--V--T--W--I--D

----------------------------------------------------------------------------------------------------
--Q--D--G--P--V--T--V--N--T--S--D--F--L--V--L--D--A--Q--N--Y--P--W--L--T--N--H--T--V--Q--L--Q--L--R-
CCAGGATGGGCCAGTGACTGTCAACACCTCTGACTTCCTGGTGCTGGATGCGCAGAACTACCCCTGGCTCACCAACCACACGGTGCAGCTGCAGCTCCGC
::::::::::::.::::::::::::.::::::::::::::::::::::::: ::::::::::::::::::::::::::::: ::::::::::::::::: 
CCAGGATGGGCCGGTGACTGTCAACGCCTCTGACTTCCTGGTGCTGGATGCCCAGAACTACCCCTGGCTCACCAACCACACTGTGCAGCTGCAGCTCCGA
--Q--D--G--P--V--T--V--N--A--S--D--F--L--V--L--D--A--Q--N--Y--P--W--L--T--N--H--T--V--Q--L--Q--L--R-

---------------------------------------------------------------------------><-----------------------
-S--L--A--H--N--L--S--V--V--A--T--N--D--V--G--V--T--S--A--S--L--P--A--P--G--L--L--A--T--R--V--E--V--
AGCCTGGCACACAACCTCTCGGTGGTGGCCACCAATGACGTGGGTGTCACCAGTGCGTCGCTTCCAGCCCCAGGGCTTCTGGCTACCCGGGTGGAAGTGC
:::::: :::::::::::::::::::.:::::::::::.::::::::::::::::: ::::::::::::      ::.:::::.::::::::::::::::
AGCCTGCCACACAACCTCTCGGTGGTAGCCACCAATGATGTGGGTGTCACCAGTGCCTCGCTTCCAGCC------CTCCTGGCCACCCGGGTGGAAGTGC
-S--L--P--H--N--L--S--V--V--A--T--N--D--V--G--V--T--S--A--S--L--P--A--------L--L--A--T--R--V--E--V--

----------------------------------------------------------------------------------------------------
P--L--L--G--I--V--V--A--A--G--L--A--L--G--T--L--V--G--F--S--T--L--V--A--C--L--V--C--R--K--E--K--K--T
CACTGCTGGGCATTGTTGTGGCTGCTGGGCTTGCACTGGGCACCCTCGTGGGGTTCAGCACCTTGGTGGCCTGCCTGGTCTGCAGAAAAGAGAAGAAAAC
:::::::::::::.::::::::::  ::.::::: :::::::: :: ::::::::::::::::::::::::::::::::::::::.:::::::::::.::
CACTGCTGGGCATCGTTGTGGCTGGAGGACTTGCCCTGGGCACACTGGTGGGGTTCAGCACCTTGGTGGCCTGCCTGGTCTGCAGGAAAGAGAAGAAGAC
P--L--L--G--I--V--V--A--G--G--L--A--L--G--T--L--V--G--F--S--T--L--V--A--C--L--V--C--R--K--E--K--K--T

-------><-----------------------------><------------------------------------------------------------
--K--G--P--S--R--H--P--S--L--I--S--S--D--S--N--N--L--K--L--N--N--V--R--L--P--R--E--N--M--S--L--P--S-
CAAAGGCCCCTCCCGGCACCCATCTCTGATATCAAGTGACTCCAACAACCTAAAACTCAACAACGTGCGCCTGCCACGGGAGAACATGTCCCTCCCGTCC
::::                                 ::::::::::::::.:::::::::::::::::.::::: ::::::::::::::::::::::::
CAAA---------------------------------GACTCCAACAACCTGAAACTCAACAACGTGCGTCTGCCCCGGGAGAACATGTCCCTCCCGTCC
--K-----------------------------------D--S--N--N--L--K--L--N--N--V--R--L--P--R--E--N--M--S--L--P--S-

---------------------------------------><-----------------------------------------------------------
-N--L--Q--L--N--D--L--T--P--D--S--R--A--V--K--P--A--D--R--Q--M--A--Q--N--N--S--R--P--E--L--L--D--P--
AACCTTCAGCTCAATGACCTCACTCCAGATTCCAGAGCAGTGAAACCAGCAGACCGGCAGATGGCTCAGAACAACAGCCGGCCAGAGCTTCTGGACCCGG
::::: ::::::::.:::::::::::.:::::::::      ::.::::..::::.:::::. :: ::::::::::::::::::::.:: ::::::::.:
AACCTGCAGCTCAACGACCTCACTCCGGATTCCAGA------AAGCCAGTGGACCAGCAGACTGCACAGAACAACAGCCGGCCAGAACTGCTGGACCCAG
-N--L--Q--L--N--D--L--T--P--D--S--R--------K--P--V--D--Q--Q--T--A--Q--N--N--S--R--P--E--L--L--D--P--

-----------------------------><---------------------------------------------------------------------
E--P--G--G--L--L--T--S--Q--G--F--I--R--L--P--V--L--G--Y--I--Y--R--V--S--S--V--S--S--D--E--I--W--L--*
AGCCCGGCGGCCTCCTCACCAGCCAAGGTTTCATCCGCCTCCCAGTGCTGGGCTATATCTATCGAGTGTCCAGCGTGAGCAGTGATGAGATCTGGCTCTG
::::.:: ::.:: ::.:::::::.:   ::::::::.:::::..::::::::::.::.:::::.::::::::.::::::::::::::::::::::::::
AGCCTGGAGGTCTGCTTACCAGCCGA---TTCATCCGTCTCCCGATGCTGGGCTACATTTATCGGGTGTCCAGTGTGAGCAGTGATGAGATCTGGCTCTG
E--P--G--G--L--L--T--S--R-----F--I--R--L--P--M--L--G--Y--I--Y--R--V--S--S--V--S--S--D--E--I--W--L--*

-
-
A
:
A
-

Pig Consensus Sequence

>BGISUST0000884571
ATGGCGCTGCTTCCCGGGCCAGCAACCCTCCCGCACACACTGCTGCTCCTGCCAGCCCTTCTGAGC------TGGGGGGAGTTGGCGCCACAAATTGATG
GTCAGACCTGGGCTGAGCGGGCACTTCGAGAGAATGAACGCCATGCCTTCACCTGCCGGGTGGCAGGGGGGCCtaCCCCCCGATTGGCCTGGTACCTGGA
TGGACAGCTACAGGAGGCCAGCTCCTCGAGACTACTGAGCGTGGGTGGGAAGGCCTTCTCCGGAGGCACCAGCACTTTCACTGTCACTGCCCAGAGGGCT
CAGCATGAGCTCAACTGCTCCCTGCAGGACCCAAGCAGTGGCCGGTCAGCCAACGCTTCCGTCATCCTCAATGTACAA---AAGCCGGAGATTGCCCAGG
GTGGGGCCAAGTACCAAGAAGCTCAGGGCCCAGGCCTCCTGGTCGTACTTTTTGCCCTGGTGCGTGCCAACCCGCCTGCCAATGTGACCTGGATCGACCA
GGATGGGCCGGTGACTGTCAACGCCTCTGACTTCCTGGTGCTGGATGCCCAGAACTACCCCTGGCTCACCAACCACACTGTGCAGCTGCAGCTCCGAAGC
CTGCCACACAACCTCTCGGTGGTAGCCACCAATGATGTGGGTGTCACCAGTGCCTCGCTTCCAGCC------CTCCTGGCCACCCGGGTGGAAGTGCCAC
TGCTGGGCATCGTTGTGGCTGGAGGACTTGCCCTGGGCACACTGGTGGGGTTCAGCACCTTGGTGGCCTGCCTGGTCTGCAGGAAAGAGAAGAAGACCAA
A---------------------------------GACTCCAACAACCTGAAACTCAACAACGTGCGTCTGCCCCGGGAGAACATGTCCCTCCCGTCCAAC
CTGCAGCTCAACGACCTCACTCCGGATTCCAGA------AAGCCAGTGGACCAGCAGACTGCACAGAACAACAGCCGGCCAGAACTGCTGGACCCAGAGC
CTGGAGGTCTGCTTACCAGCCGA---TTCATCCGTCTCCCGATGCTGGGCTACATTTATCGGGTGTCCAGTGTGAGCAGTGATGAGATCTGGCTCTGA


>BGISUSP0000884571
MALLPGPATLPHTLLLLPALLS--WGELAPQIDGQTWAERALRENERHAFTCRVAGGPTPRLAWYLDGQLQEASSSRLLSVGGKAFSGGTSTFTVTAQRA
QHELNCSLQDPSSGRSANASVILNVQ-KPEIAQGGAKYQEAQGPGLLVVLFALVRANPPANVTWIDQDGPVTVNASDFLVLDAQNYPWLTNHTVQLQLRS
LPHNLSVVATNDVGVTSASLPA--LLATRVEVPLLGIVVAGGLALGTLVGFSTLVACLVCRKEKKTK-----------DSNNLKLNNVRLPRENMSLPSN
LQLNDLTPDSR--KPVDQQTAQNNSRPELLDPEPGGLLTSR-FIRLPMLGYIYRVSSVSSDEIWL*