Sequences
EST Library Info
eru4Foetus 50 days, regio umbilicalis
spl1Spleen
ssp3M. Supraspinatus
uio2Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000092439 (click for geneview)
Transcript ID ENST00000313478(link to ensembl)
Symbol TRPM7
Localtion Chromosome:15:48639787:48766287:-1 band: 15q21.2
Description Transient receptor potential cation channel subfamily M member 7 (EC 2.7.1.37) (Long transient receptor potential channel 7) (LTrpC7) (Channel-kinase 1). [Source:Uniprot/SWISSPROT;Acc:Q96QT4]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-><------------------------------------------------------------------------------><----------------
-M--S--Q--K--S--W--I--E--S--T--L--T--K--R--E--C--V--Y--I--I--P--S--S--K--D--P--H--R--C--L--P--G--C--
ATGTCCCAGAAATCCTGGATAGAAAGCACTTTGACCAAGAGGGAATGTGTATATATTATACCAAGTTCCAAGGACCCTCACAGATGCCTTCCAGGATGTC
   :::::::::::::::::::::::::::::::::::::::::::::::.:::::::::::.::::::::.:::::::::   ::::::::::::::::
---TCCCAGAAATCCTGGATAGAAAGCACTTTGACCAAGAGGGAATGTGTGTATATTATACCGAGTTCCAAAGACCCTCAC---TGCCTTCCAGGATGTC
----S--Q--K--S--W--I--E--S--T--L--T--K--R--E--C--V--Y--I--I--P--S--S--K--D--P--H-----C--L--P--G--C--

---------------------><-----------------------------------------------------------------------------
Q--I--C--Q--Q--L--V--R--C--F--C--G--R--L--V--K--Q--H--A--C--F--T--A--S--L--A--M--K--Y--S--D--V--K--L
AAATTTGTCAGCAACTCGTCAGGTGTTTTTGTGGTCGCTTGGTCAAGCAACATGCTTGTTTTACTGCAAGTCTTGCCATGAAATACTCAGATGTGAAATT
::::::::::::::::::::   :::::::::::::::::::::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::
AAATTTGTCAGCAACTCGTC---TGTTTTTGTGGTCGCTTGGTCAAGCAACATGCTTGTTTTACCGCAAGTCTTGCCATGAAATACTCAGATGTGAAATT
Q--I--C--Q--Q--L--V-----C--F--C--G--R--L--V--K--Q--H--A--C--F--T--A--S--L--A--M--K--Y--S--D--V--K--L

----------------------------------------------------------------------------------------------------
--G--D--H--F--N--Q--A--I--E--E--W--S--V--E--K--H--T--E--Q--S--P--T--D--A--Y--G--V--I--N--F--Q--G--G-
GGGTGACCATTTTAATCAGGCAATAGAAGAATGGTCTGTGGAAAAGCATACAGAACAGAGCCCAACGGATGCTTATGGAGTCATAAATTTTCAAGGGGGT
:::::::::::::::::::.:: :::::::.:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
GGGTGACCATTTTAATCAGACATTAGAAGAGTGGTCTGTGGAAAAGCATACAGAACAGAGCCCAACGGATGCTTATGGAGTCATAAATTTTCAAGGGGGT
--G--D--H--F--N--Q--T--L--E--E--W--S--V--E--K--H--T--E--Q--S--P--T--D--A--Y--G--V--I--N--F--Q--G--G-

--------------------><------------------------------------------------------------------------------
-S--H--S--Y--R--A--K--Y--V--R--L--S--Y--D--T--K--P--E--V--I--L--Q--L--L--L--K--E--W--Q--M--E--L--P--
TCTCATTCCTACAGAGCTAAGTATGTGAGGCTATCATATGACACCAAACCTGAAGTCATTCTGCAACTTCTGCTTAAAGAATGGCAAATGGAGTTACCCA
::::::::::::::::: ::::::::: ::::::::::::::::::::::::::::::::::.:::::::::.: :::::::::::::::::.:::::::
TCTCATTCCTACAGAGCAAAGTATGTGCGGCTATCATATGACACCAAACCTGAAGTCATTCTACAACTTCTGTTGAAAGAATGGCAAATGGAATTACCCA
-S--H--S--Y--R--A--K--Y--V--R--L--S--Y--D--T--K--P--E--V--I--L--Q--L--L--L--K--E--W--Q--M--E--L--P--

----------------------------------------------------------------------------------------------------
K--L--V--I--S--V--H--G--G--M--Q--K--F--E--L--H--P--R--I--K--Q--L--L--G--K--G--L--I--K--A--A--V--T--T
AACTTGTTATCTCTGTACATGGGGGCATGCAGAAATTTGAGCTTCACCCACGAATCAAGCAGTTGCTTGGAAAAGGTCTTATTAAAGCTGCAGTTACAAC
:::::::::::::::::::.:: ::::::::::::::::::::::::::::::::.::.::::::::::::::.::::::::.:::::::::::::::::
AACTTGTTATCTCTGTACACGGTGGCATGCAGAAATTTGAGCTTCACCCACGAATTAAACAGTTGCTTGGAAAGGGTCTTATCAAAGCTGCAGTTACAAC
K--L--V--I--S--V--H--G--G--M--Q--K--F--E--L--H--P--R--I--K--Q--L--L--G--K--G--L--I--K--A--A--V--T--T

----------------------------------><----------------------------------------------------------------
--G--A--W--I--L--T--G--G--V--N--T--G--V--A--K--H--V--G--D--A--L--K--E--H--A--S--R--S--S--R--K--I--C-
TGGAGCCTGGATTTTAACTGGAGGAGTAAACACAGGTGTGGCAAAACATGTTGGAGATGCCCTCAAAGAACATGCTTCCAGATCATCTCGAAAGATTTGC
::::::.:::::::::::::::::::::::::::   ::::::::::::::::: ::::::::.::::::::::::::::::::::::::::::::::::
TGGAGCTTGGATTTTAACTGGAGGAGTAAACACA---GTGGCAAAACATGTTGGTGATGCCCTTAAAGAACATGCTTCCAGATCATCTCGAAAGATTTGC
--G--A--W--I--L--T--G--G--V--N--T-----V--A--K--H--V--G--D--A--L--K--E--H--A--S--R--S--S--R--K--I--C-

-----------------------------------------------------------><---------------------------------------
-T--I--G--I--A--P--W--G--V--I--E--N--R--N--D--L--V--G--R--D--V--V--A--P--Y--Q--T--L--L--N--P--L--S--
ACTATCGGAATAGCTCCATGGGGAGTGATTGAAAACAGAAATGATCTTGTTGGGAGAGATGTGGTTGCTCCTTATCAAACCTTATTGAACCCCCTGAGCA
::.::::::::::::::.::::::::::::::::::::::::::::::::::::::::::::::::::::::::.::::: :::::::::::.:::::::
ACCATCGGAATAGCTCCGTGGGGAGTGATTGAAAACAGAAATGATCTTGTTGGGAGAGATGTGGTTGCTCCTTACCAAACGTTATTGAACCCTCTGAGCA
-T--I--G--I--A--P--W--G--V--I--E--N--R--N--D--L--V--G--R--D--V--V--A--P--Y--Q--T--L--L--N--P--L--S--

----------------------------------------------------------------------------------------------------
K--L--N--V--L--N--N--L--H--S--H--F--I--L--V--D--D--G--T--V--G--K--Y--G--A--E--V--R--L--R--R--E--L--E
AATTGAATGTTTTGAATAATCTGCATTCCCATTTCATATTGGTGGATGATGGCACTGTTGGAAAGTATGGGGCGGAAGTCAGACTGAGAAGAGAACTTGA
:::::::::::.::::::::::.::::::::::::::::::::::::::::::::::::::::::::::::::.:::::::::::.::::::::::::::
AATTGAATGTTCTGAATAATCTACATTCCCATTTCATATTGGTGGATGATGGCACTGTTGGAAAGTATGGGGCAGAAGTCAGACTAAGAAGAGAACTTGA
K--L--N--V--L--N--N--L--H--S--H--F--I--L--V--D--D--G--T--V--G--K--Y--G--A--E--V--R--L--R--R--E--L--E

-------------------------------><-------------------------------------------------------------------
--K--T--I--N--Q--Q--R--I--H--A--R--I--G--Q--G--V--P--V--V--A--L--I--F--E--G--G--P--N--V--I--L--T--V-
AAAAACTATTAATCAGCAAAGAATTCATGCTAGGATTGGCCAGGGTGTCCCTGTGGTGGCACTTATATTTGAGGGTGGGCCAAATGTTATCCTCACAGTT
:::::::::::::::::::::::::::::::   :::::.::.:::::::::::::::::::::::::::::.::.::::::::::::::::::::::::
AAAAACTATTAATCAGCAAAGAATTCATGCT---ATTGGTCAAGGTGTCCCTGTGGTGGCACTTATATTTGAAGGCGGGCCAAATGTTATCCTCACAGTT
--K--T--I--N--Q--Q--R--I--H--A-----I--G--Q--G--V--P--V--V--A--L--I--F--E--G--G--P--N--V--I--L--T--V-

----------------------------------------------------------------------------------------------------
-L--E--Y--L--Q--E--S--P--P--V--P--V--V--V--C--E--G--T--G--R--A--A--D--L--L--A--Y--I--H--K--Q--T--E--
CTTGAATACCTTCAGGAAAGCCCCCCTGTTCCAGTAGTTGTGTGTGAAGGAACAGGCAGAGCTGCAGATCTGCTAGCGTATATTCATAAACAAACAGAAG
.: :::::::::::::::::.::.::::::::::: ::.::.:::::::::::::: ::::::::::::::.:::::.::: ::::::::::::::::::
TTAGAATACCTTCAGGAAAGTCCTCCTGTTCCAGTTGTCGTATGTGAAGGAACAGGGAGAGCTGCAGATCTACTAGCATATCTTCATAAACAAACAGAAG
-L--E--Y--L--Q--E--S--P--P--V--P--V--V--V--C--E--G--T--G--R--A--A--D--L--L--A--Y--L--H--K--Q--T--E--

------><--------------------------------------------------------------------------------------------
E--G--G--N--L--P--D--A--A--E--P--D--I--I--S--T--I--K--K-----T--F--N--F--G--Q--N--E--A--L--H--L--F--Q
AAGGAGGGAATCTTCCTGATGCAGCAGAGCCCGATATTATTTCCACTATCAAAAAA---ACATTTAACTTTGGCCAGAATGAAGCACTTCATTTATTTCA
::      ::::::::::::::::::::::: ::::::::::: ::.:::::::::   :: ::::::::::::::.:.::::::: :::::::::::::
AA------AATCTTCCTGATGCAGCAGAGCCAGATATTATTTCAACCATCAAAAAAA--ACTTTTAACTTTGGCCAAAGTGAAGCAGTTCATTTATTTCA
E--------N--L--P--D--A--A--E--P--D--I--I--S--T--I--K--K--\--T--F--N--F--G--Q--S--E--A--V--H--L--F--Q

---------------------------------><-----------------------------------------------------------------
--T--L--M--E--C--M--K--R--K--E--L--I--T--V--F--H--I--G--S--D--E--H--Q--D--I--D--V--A--I--L--T--A--L-
AACACTGATGGAGTGCATGAAAAGAAAGGAGCTTATCACTGTTTTCCATATTGGGTCAGATGAACATCAAGATATAGATGTAGCAATACTTACTGCACTG
.::::::::::::::.::::::::::::::::::::.:::::::::::.:::::.::::::::::::::::::::::::::::::::::: :::::::::
GACACTGATGGAGTGTATGAAAAGAAAGGAGCTTATTACTGTTTTCCACATTGGATCAGATGAACATCAAGATATAGATGTAGCAATACTAACTGCACTG
--T--L--M--E--C--M--K--R--K--E--L--I--T--V--F--H--I--G--S--D--E--H--Q--D--I--D--V--A--I--L--T--A--L-

------><--------------------------------------------------------------------------------------------
-L--K--G--T--N--A--S--A--F--D--Q--L--I--L--T--L--A--W--D--R--V--D--I--A--K--N--H--V--F--V--Y--G--Q--
CTAAAAGGTACTAATGCATCTGCATTTGACCAGCTTATCCTTACATTGGCATGGGATAGAGTTGACATTGCCAAAAATCATGTATTTGTTTATGGACAGC
:: :::                                                                                              
CTTAAA----------------------------------------------------------------------------------------------
-L--K-----------------------------------------------------------------------------------------------

-------><-------------------------------------------------------------------------------------------
Q--W--L--V--G--S--L--E--Q--A--M--L--D--A--L--V--M--D--R--V--A--F--V--K--L--L--I--E--N--G--V--S--M--H
AGTGGCTGGTTGGATCCTTGGAACAAGCTATGCTTGATGCTCTTGTAATGGATAGAGTTGCATTTGTAAAACTTCTTATTGAAAATGGAGTAAGCATGCA
        ::::::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
--------GTTGGATCCTTGGAACAAGCTATGCTCGATGCTCTTGTAATGGATAGAGTTGCATTTGTAAAACTTCTTATTGAAAATGGAGTAAGCATGCA
---------V--G--S--L--E--Q--A--M--L--D--A--L--V--M--D--R--V--A--F--V--K--L--L--I--E--N--G--V--S--M--H

------------------------------------------><----------------------------------------------------><--
--K--F--L--T--I--P--R--L--E--E--L--Y--N--T--K--Q--G--P--T--N--P--M--L--F--H--L--V--R--D--V--K--Q--G-
TAAATTCCTTACCATTCCGAGACTGGAAGAACTTTACAACACTAAACAAGGTCCAACTAATCCAATGCTGTTTCATCTTGTTCGAGACGTCAAACAGGGA
:::::::::::::::::: ::::::::::::::::::::::::                                                      :::
TAAATTCCTTACCATTCCTAGACTGGAAGAACTTTACAACACT------------------------------------------------------GGA
--K--F--L--T--I--P--R--L--E--E--L--Y--N--T--------------------------------------------------------G-

----------------------------------------------------------------------------------------------------
-N--L--P--P--G--Y--K--I--T--L--I--D--I--G--L--V--I--E--Y--L--M--G--G--T--Y--R--C--T--Y--T--R--K--R--
AATCTTCCTCCAGGATATAAGATCACTCTGATTGATATAGGACTTGTTATTGAATATCTCATGGGAGGAACCTACAGATGCACCTATACTAGGAAACGTT
:::::::::::::::::::::::::::::.::.:::::::::::::::::::::::::::::::::::::::::.::::::::::::::: :::::::::
AATCTTCCTCCAGGATATAAGATCACTCTAATCGATATAGGACTTGTTATTGAATATCTCATGGGAGGAACCTATAGATGCACCTATACTCGGAAACGTT
-N--L--P--P--G--Y--K--I--T--L--I--D--I--G--L--V--I--E--Y--L--M--G--G--T--Y--R--C--T--Y--T--R--K--R--

-------------------------------------><-------------------------------------------------------------
F--R--L--I--Y--N--S--L--G--G--N--N--R--R--S--G--R--N--T--S--S--S--T--P--Q--L--R--K--S--H--E--S--F--G
TTCGATTAATATATAATAGTCTTGGTGGAAATAATCGGAGGTCTGGCCGAAATACCTCCAGCAGCACTCCTCAGTTGCGAAAGAGTCATGAATCTTTTGG
:::::.:.::::::::.::.::::::::.::::.::::            ::::::::::::::::::::::::::: :::::::::: :::::::::: 
TTCGACTGATATATAACAGCCTTGGTGGGAATAGTCGG------------AATACCTCCAGCAGCACTCCTCAGTTGAGAAAGAGTCAAGAATCTTTTGN
F--R--L--I--Y--N--S--L--G--G--N--S--R--------------N--T--S--S--S--T--P--Q--L--R--K--S--Q--E--S--F--X

------------------------------------------------------------------------><--------------------------
--N--R--A--D--K--K--E--K--M--R--H--N--H--F--I--K--T--A--Q--P--Y--R--P--K--I--D--T--V--M--E--E--G--K-
CAATAGGGCAGATAAAAAGGAAAAAATGAGGCATAACCATTTCATTAAGACAGCACAGCCCTACCGACCAAAGATTGATACAGTTATGGAAGAAGGAAAG
::::::.:::::::::::::::::::::::.:::::.:::::::::::.:::::::::::::::::::: ::::::::::::.. .::::::::::::::
CAATAGAGCAGATAAAAAGGAAAAAATGAGACATAATCATTTCATTAAAACAGCACAGCCCTACCGACCNAAGATTGATACAACAGTGGAAGAAGGAAAG
--N--R--A--D--K--K--E--K--M--R--H--N--H--F--I--K--T--A--Q--P--Y--R--X--K--I--D--T--T--V--E--E--G--K-

----------------------------------------------------------------------------------------------------
-K--K--R--T--K--D--E--I--V--D--I--D--D--P--E--T--K--R--F--P--Y--P--L--N--E--L--L--I--W--A--C--L--M--
AAGAAAAGAACCAAAGATGAAATTGTAGACATTGATGATCCAGAAACCAAGCGCTTTCCTTATCCACTTAATGAACTTTTAATTTGGGCTTGCCTTATGA
:::::::::::::::::::::::::::::.::::::::::::::::::::::::::::::::::::::::::::::: ::::::::::::::::::::::
AAGAAAAGAACCAAAGATGAAATTGTAGATATTGATGATCCAGAAACCAAGCGCTTTCCTTATCCACTTAATGAACTGTTAATTTGGGCTTGCCTTATGA
-K--K--R--T--K--D--E--I--V--D--I--D--D--P--E--T--K--R--F--P--Y--P--L--N--E--L--L--I--W--A--C--L--M--

----------------------------------------------------------------------------------------------------
K--R--Q--V--M--A--R--F--L--W--Q--H--G--E--E--S--M--A--K--A--L--V--A--C--K--I--Y--R--S--M--A--Y--E--A
AGAGGCAGGTCATGGCCCGTTTTTTATGGCAACATGGTGAAGAATCAATGGCTAAAGCATTAGTTGCCTGTAAGATCTATCGTTCAATGGCATATGAAGC
:::::::::::::::::::::::.:::::::.::::::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::::::
AGAGGCAGGTCATGGCCCGTTTTCTATGGCAGCATGGTGAAGAATCAATGGCTAAAGCGTTAGTTGCCTGTAAGATCTATCGTTCAATGGCATATGAAGC
K--R--Q--V--M--A--R--F--L--W--Q--H--G--E--E--S--M--A--K--A--L--V--A--C--K--I--Y--R--S--M--A--Y--E--A

-----------------------------------------------------><---------------------------------------------
--K--Q--S--D--L--V--D--D--T--S--E--E--L--K--Q--Y--S--N--D--F--G--Q--L--A--V--E--L--L--E--Q--S--F--R-
AAAGCAGAGTGACCTGGTAGATGATACTTCAGAAGAACTAAAACAGTATTCCAATGATTTTGGTCAGTTGGCCGTTGAATTATTAGAACAGTCCTTCAGA
::::::::::::::: :::::::::::::::::.:::.:.::::::::::::                                                
AAAGCAGAGTGACCTTGTAGATGATACTTCAGAGGAATTGAAACAGTATTCC------------------------------------------------
--K--Q--S--D--L--V--D--D--T--S--E--E--L--K--Q--Y--S-------------------------------------------------

----------------------------------------------------------------------------------------------------
-Q--D--E--T--M--A--M--K--L--L--T--Y--E--L--K--N--W--S--N--S--T--C--L--K--L--A--V--S--S--R--L--R--P--
CAAGATGAAACCATGGCTATGAAATTGCTCACTTATGAACTGAAGAACTGGAGTAATTCAACCTGCCTTAAGTTAGCAGTTTCTTCAAGACTTAGACCTT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------><----------------
F--V--A--H--T--C--T--Q--M--L--L--S--D--M--W--M--G--R--L--N--M--R--K--N--S--W--Y--K--V--I--L--S--I--L
TTGTAGCTCACACCTGTACACAAATGTTGTTATCTGATATGTGGATGGGAAGGCTGAATATGAGGAAAAATTCCTGGTACAAGGTCATACTAAGCATTTT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--V--P--P--A--I--L--L--L--E--Y--K--T--K--A--E--M--S--H--I--P--Q--S--Q--D--A--H--Q--M--T--M--D--D--S-
AGTTCCACCTGCCATATTGCTGTTAGAGTATAAAACTAAGGCTGAAATGTCCCATATCCCACAATCTCAAGATGCTCATCAGATGACAATGGATGACAGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------------------------><------------------------------------------------------------
-E--N--N--F--Q--N--I--T--E--E--I--P--M--E--V--F--K--E--V--R--I--L--D--S--N--E--G--K--N--E--M--E--I--
GAAAACAACTTTCAGAACATAACAGAAGAGATCCCCATGGAAGTGTTTAAAGAAGTACGGATTTTGGATAGTAATGAAGGAAAGAATGAGATGGAGATAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------><----------------
Q--M--K--S--K--K--L--P--I--T--R--K--F--Y--A--F--Y--H--A--P--I--V--K--F--W--F--N--T--L--A--Y--L--G--F
AAATGAAATCAAAAAAGCTTCCAATTACGCGAAAGTTTTATGCCTTTTATCATGCACCAATTGTAAAATTCTGGTTTAACACGTTGGCATATTTAGGATT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--L--M--L--Y--T--F--V--V--L--V--Q--M--E--Q--L--P--S--V--Q--E--W--I--V--I--A--Y--I--F--T--Y--A--I--E-
TCTGATGCTTTATACATTTGTGGTTCTTGTACAAATGGAACAGTTACCTTCAGTTCAAGAATGGATTGTTATTGCTTATATTTTTACTTATGCCATTGAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----------><---------------------------------------------------------------------------------------
-K--V--R--E--I--F--M--S--E--A--G--K--V--N--Q--K--I--K--V--W--F--S--D--Y--F--N--I--S--D--T--I--A--I--
AAAGTCCGTGAGATCTTTATGTCTGAAGCTGGGAAAGTAAACCAGAAGATTAAAGTATGGTTTAGTGATTACTTCAACATCAGTGATACAATTGCCATAA
            ::::::::::::::::::::.:::.:::.:::::::::::::::.::::::::::::::::::::.::::::::::: ::::::::::
------------ATCTTTATGTCTGAAGCTGGAAAAATAAGCCAGAAGATTAAAGTGTGGTTTAGTGATTACTTCAATATCAGTGATACNATTGCCATAA
-------------I--F--M--S--E--A--G--K--I--S--Q--K--I--K--V--W--F--S--D--Y--F--N--I--S--D--X--I--A--I--

----------------------------------------------------------------------------------------------------
I--S--F--F--I--G--F--G--L--R--F--G--A--K--W--N--F--A--N--A--Y--D--N--H--V--F--V--A--G--R--L--I--Y--C
TTTCTTTCTTCATTGGATTTGGACTAAGATTTGGAGCAAAATGGAACTTTGCAAATGCATATGATAATCATGTTTTTGTGGCTGGAAGATTAATTTACTG
::::::::::::::::::::::::::::::::::::: ::::::::::::: .:::::::::::::::::::::::::::::::::::::::::::::::
TTTCTTTCTTCATTGGATTTGGACTAAGATTTGGAGCNAAATGGAACTTTGAGAATGCATATGATAATCATGTTTTTGTGGCTGGAAGATTAATTTACTG
I--S--F--F--I--G--F--G--L--R--F--G--X--K--W--N--F--E--N--A--Y--D--N--H--V--F--V--A--G--R--L--I--Y--C

------------------------------------------------------------------------------------------><--------
--L--N--I--I--F--W--Y--V--R--L--L--D--F--L--A--V--N--Q--Q--A--G--P--Y--V--M--M--I--G--K--M--V--A--N-
TCTTAACATAATATTTTGGTATGTGCGTTTGCTAGATTTTCTAGCTGTAAATCAACAGGCAGGACCTTATGTAATGATGATTGGAAAAATGGTGGCCAAT
::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
TCTTAACATAATATTTTGGTATGTGCGTTTGCTAGATTTTCTAGCTGTAAATCAACAGGCAGGACCTTATGTAATGATGATTGGAAAAATGGTGGCCAAT
--L--N--I--I--F--W--Y--V--R--L--L--D--F--L--A--V--N--Q--Q--A--G--P--Y--V--M--M--I--G--K--M--V--A--N-

----------------------------------------------------------------------------------------------------
-M--F--Y--I--V--V--I--M--A--L--V--L--L--S--F--G--V--P--R--K--A--I--L--Y--P--H--E--A--P--S--W--T--L--
ATGTTCTACATTGTAGTGATTATGGCTCTTGTATTACTTAGTTTTGGTGTTCCCAGAAAGGCAATACTTTATCCTCATGAAGCACCATCTTGGACTCTTG
::::: :::::::::::::::::::::::::::::::::::::::::::::::.::::::::::::::::::::::::::::::::::::::::::::::
ATGTTNTACATTGTAGTGATTATGGCTCTTGTATTACTTAGTTTTGGTGTTCCTAGAAAGGCAATACTTTATCCTCATGAAGCACCATCTTGGACTCTTG
-M--X--Y--I--V--V--I--M--A--L--V--L--L--S--F--G--V--P--R--K--A--I--L--Y--P--H--E--A--P--S--W--T--L--

-----------------------------------------------------------------><---------------------------------
A--K--D--I--V--F--H--P--Y--W--M--I--F--G--E--V--Y--A--Y--E--I--D--V--C--A--N--D--S--V--I--P--Q--I--C
CTAAAGATATAGTTTTTCACCCATACTGGATGATTTTTGGTGAAGTTTATGCATACGAAATTGATGTGTGTGCAAATGATTCTGTTATCCCTCAAATCTG
:::::::::::::::::::.:::::::::::::::::.:::::::::::::::::.:::::::::   ::::::::::::::  .:::.: : :::::::
CTAAAGATATAGTTTTTCATCCATACTGGATGATTTTCGGTGAAGTTTATGCATATGAAATTGAT---TGTGCAAATGATTCATCTATTCGTGAAATCTG
A--K--D--I--V--F--H--P--Y--W--M--I--F--G--E--V--Y--A--Y--E--I--D-----C--A--N--D--S--S--I--R--E--I--C

--------------------------------------------------------------------------------------------><------
--G--P--G--T--W--L--T--P--F--L--Q--A--V--Y--L--F--V--Q--Y--I--I--M--V--N--L--L--I--A--F--F--N--N--V-
TGGTCCTGGGACGTGGTTGACTCCATTTCTTCAAGCAGTCTACCTCTTTGTACAGTATATCATTATGGTTAATCTTCTTATTGCATTTTTCAACAATGTG
::::::::::::.::::::::::::::::::::::::::::::::::::::::::::::::::::::::.::::::::.::::::::::::   :::::.
TGGTCCTGGGACATGGTTGACTCCATTTCTTCAAGCAGTCTACCTCTTTGTACAGTATATCATTATGGTCAATCTTCTCATTGCATTTTTC---AATGTA
--G--P--G--T--W--L--T--P--F--L--Q--A--V--Y--L--F--V--Q--Y--I--I--M--V--N--L--L--I--A--F--F-----N--V-

----------------------------------------------------------------------------------------------------
-Y--L--Q--V--K--A--I--S--N--I--V--W--K--Y--Q--R--Y--H--F--I--M--A--Y--H--E--K--P--V--L--P--P--P--L--
TATTTACAAGTGAAGGCAATTTCCAATATTGTATGGAAGTACCAGCGTTATCATTTTATTATGGCTTATCATGAGAAACCAGTTCTGCCTCCTCCACTTA
:::::::::::::::::::::::.::::::::::::::.:::::.:::::::::::::::::::::::::::::::::::::::.::::::: :::::::
TATTTACAAGTGAAGGCAATTTCTAATATTGTATGGAAATACCAACGTTATCATTTTATTATGGCTTATCATGAGAAACCAGTTTTGCCTCCACCACTTA
-Y--L--Q--V--K--A--I--S--N--I--V--W--K--Y--Q--R--Y--H--F--I--M--A--Y--H--E--K--P--V--L--P--P--P--L--

-----------------------------------------------------------------------------><---------------------
I--I--L--S--H--I--V--S--L--F--C--C--I--C--K--R--R--K--K--D--K--T--S--D--G--P--K--L--F--L--T--E--E--D
TCATTCTTAGCCATATAGTTTCTCTGTTTTGCTGCATATGTAAGAGAAGAAAGAAAGATAAGACTTCCGATGGACCAAAACTTTTCTTAACAGAAGAAGA
:::::::.:::::::::::::::::::::::::::::::::::.:::::.::.:::::::::::::: :::::.:::   :::::.::::::::::::::
TCATTCTCAGCCATATAGTTTCTCTGTTTTGCTGCATATGTAAAAGAAGGAAAAAAGATAAGACTTCAGATGGGCCA---CTTTTTTTAACAGAAGAAGA
I--I--L--S--H--I--V--S--L--F--C--C--I--C--K--R--R--K--K--D--K--T--S--D--G--P-----L--F--L--T--E--E--D

----------------------------------------------------------------------------------------------------
--Q--K--K--L--H--D--F--E--E--Q--C--V--E--M--Y--F--N--E--K--D--D--K--F--H--S--G--S--E--E--R--I--R--V-
TCAAAAGAAACTTCATGATTTTGAAGAGCAGTGTGTTGAAATGTATTTCAATGAAAAAGATGACAAATTTCATTCTGGGAGTGAAGAGAGAATTCGTGTC
:::::::::::::::::::::::::::::::::::::::.::::::::.::::::::::::::::::::.:::::::: ::.::::::::::::::::::
TCAAAAGAAACTTCATGATTTTGAAGAGCAGTGTGTTGAGATGTATTTTAATGAAAAAGATGACAAATTCCATTCTGGTAGCGAAGAGAGAATTCGTGTC
--Q--K--K--L--H--D--F--E--E--Q--C--V--E--M--Y--F--N--E--K--D--D--K--F--H--S--G--S--E--E--R--I--R--V-

----------><----------------------------------------------------------------------------------------
-T--F--E--R--V--E--Q--M--C--I--Q--I--K--E--V--G--D--R--V--N--Y--I--K--R--S--L--Q--S--L--D--S--Q--I--
ACTTTTGAAAGAGTGGAACAGATGTGCATTCAGATTAAAGAAGTTGGAGATCGTGTCAACTACATAAAAAGATCATTACAATCATTAGATTCTCAAATTG
:::::::::   :::::.::::::::::::::::::::::::::::::::::::::::::::.:: ::::::::.:::::.:::::::::::::::::::
ACTTTTGAA---GTGGAGCAGATGTGCATTCAGATTAAAGAAGTTGGAGATCGTGTCAACTATATCAAAAGATCGTTACAGTCATTAGATTCTCAAATTG
-T--F--E-----V--E--Q--M--C--I--Q--I--K--E--V--G--D--R--V--N--Y--I--K--R--S--L--Q--S--L--D--S--Q--I--

----------------------------------------------------------------------------------------------------
G--H--L--Q--D--L--S--A--L--T--V--D--T--L--K--T--L--T--A--Q--K--A--S--E--A--S--K--V--H--N--E--I--T--R
GCCATTTGCAAGATCTTTCAGCCCTGACGGTAGATACATTAAAAACACTCACTGCCCAGAAAGCGTCGGAAGCTAGCAAAGTTCATAATGAAATCACACG
:::::::::::::::::::::::::::: :::::::: :::::::::::.:::::::::::::: ::.:::::::::::::::::.::::::::.:::::
GCCATTTGCAAGATCTTTCAGCCCTGACCGTAGATACCTTAAAAACACTTACTGCCCAGAAAGCTTCAGAAGCTAGCAAAGTTCACAATGAAATTACACG
G--H--L--Q--D--L--S--A--L--T--V--D--T--L--K--T--L--T--A--Q--K--A--S--E--A--S--K--V--H--N--E--I--T--R

----------------------------------------------------------------------------------------------------
--E--L--S--I--S--K--H--L--A--Q--N--L--I--D--D--G--P--V--R--P--S--V--W--K--K--H--G--V--V--N--T--L--S-
AGAACTGAGCATTTCCAAACACTTGGCTCAAAACCTTATTGATGATGGTCCTGTAAGACCTTCTGTATGGAAAAAGCATGGTGTTGTAAATACACTTAGC
::::.:::::.::::.:::::.:::::::::::::::::::::::::::::..:::::::::::::::::::::::::..::::::::::::::::::::
AGAATTGAGCGTTTCTAAACATTTGGCTCAAAACCTTATTGATGATGGTCCCATAAGACCTTCTGTATGGAAAAAGCACAGTGTTGTAAATACACTTAGC
--E--L--S--V--S--K--H--L--A--Q--N--L--I--D--D--G--P--I--R--P--S--V--W--K--K--H--S--V--V--N--T--L--S-

----------------------------------------------------------------------------------------------------
-S--S--L--P--Q--G--D--L--E--S--N--N--P--F--H--C--N--I--L--M--K--D--D--K--D--P--Q--C--N--I--F--G--Q--
TCCTCTCTTCCTCAAGGTGATCTTGAAAGTAATAATCCTTTTCATTGTAATATTTTAATGAAAGATGACAAAGATCCCCAGTGTAATATATTTGGTCAAG
::::::::::: :::.:::.:::::::::::::::::: :::: :::::::::::: ::::::::::: :::::::::::.:::::::::::::::::.:
TCCTCTCTTCCGCAAAGTGGTCTTGAAAGTAATAATCCATTTCTTTGTAATATTTTTATGAAAGATGAAAAAGATCCCCAATGTAATATATTTGGTCAGG
-S--S--L--P--Q--S--G--L--E--S--N--N--P--F--L--C--N--I--F--M--K--D--E--K--D--P--Q--C--N--I--F--G--Q--

----------------------------------------------------------------------------------------------------
D--L--P--A--V--P--Q--R--K--E--F--N--F--P--E--A--G--S--S--S--G--A--L--F--P--S--A--V--S--P--P--E--L--R
ACTTACCTGCAGTACCCCAGAGAAAAGAATTTAATTTTCCAGAGGCTGGTTCCTCTTCTGGTGCCTTATTCCCAAGTGCTGTTTCCCCTCCAGAACTGCG
:.:::::::.:.::::::..:.:                                                                             
ATTTACCTGTAATACCCCGAAAA-----------------------------------------------------------------------------
D--L--P--V--I--P--R--K------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--Q--R--L--H--G--V--E--L--L--K--I--F--N--K--N--Q--K--L--G--S--S--S--T--S--I--P--H--L--S--S--P--P--T-
ACAGAGACTACATGGGGTAGAACTCTTAAAAATATTTAATAAAAATCAAAAATTAGGCAGTTCATCTACTAGCATACCACATCTGTCATCCCCACCAACC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-K--F--F--V--S--T--P--S--Q--P--S--C--K--S--H--L--E--T--G--T--K--D--Q--E--T--V--C--S--K--A--T--E--G--
AAATTTTTTGTTAGTACACCATCTCAGCCAAGTTGCAAAAGCCACTTGGAAACTGGAACCAAAGATCAAGAAACTGTTTGCTCTAAAGCTACAGAAGGAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------------><---------------------------------------------------------------><-------
D--N--T--E--F--G--A--F--V--G--H--R--D--S--M--D--L--Q--R--F--K--E--T--S--N--K--I--K--I--L--S--N--N--N
ATAATACAGAATTTGGAGCATTTGTAGGACACAGAGATAGCATGGATTTACAGAGGTTTAAAGAAACATCAAACAAGATAAAAATACTATCCAATAACAA
                             :::::::::::::::::::::::::::::::::::::::.::::::::::::::         :::.:.: 
-----------------------------CACAGAGATAGCATGGATTTACAGAGGTTTAAAGAAACACCAAACAAGATAAAA---------AATGATAT
------------------------------H--R--D--S--M--D--L--Q--R--F--K--E--T--P--N--K--I--K-----------N--D--I

----------------------------------------------------------------------------------------><----------
--T--S--E--N--T--L--K--R--V--S--S--L--A--G--F--T--D--C--H--R--T--S--I--P--V--H--S--K--Q--A--E--K--I-
TACTTCTGAAAACACTTTGAAACGAGTGAGTTCTCTTGCTGGATTTACTGACTGTCACAGAACTTCCATTCCTGTTCATTCAAAACAAGCAGAAAAAATC
: :::::.:::::::::::::::. ::::::.::: ::::::::::::::: :::::::.::::::..::::: ::::.:::.:::::   ::::. : :
TCCTTCTAAAAACACTTTGAAACACGTGAGTCCTCATGCTGGATTTACTGAGTGTCACAAAACTTCTGTTCCTCTTCACTCAGAACAA---GAAAGTAGC
--P--S--K--N--T--L--K--H--V--S--P--H--A--G--F--T--E--C--H--K--T--S--V--P--L--H--S--E--Q-----E--S--S-

-----------------------------------------------------------><---------------------------------><----
-S--R--R--P--S--T--E--D--T--H--E--V--D--S--K--A--A--L--I--P--D--W--L--Q--D--R--P--S--N--R--E--M--P--
AGTAGAAGGCCATCTACCGAAGACACTCATGAAGTAGATTCCAAAGCAGCTTTAATACCGGATTGGTTACAAGATAGACCATCAAACAGAGAAATGCCAT
::::::::::.:::::: ::::: :::::::::::::::::::::::::::::: :::::                                        
AGTAGAAGGCTATCTACAGAAGAAACTCATGAAGTAGATTCCAAAGCAGCTTTACTACCG----------------------------------------
-S--R--R--L--S--T--E--E--T--H--E--V--D--S--K--A--A--L--L--P-----------------------------------------

--------------------><-------------------------------------------------><---------------------------
S--E--E--G--T--L--N--G--L--T--S--P--F--K--P--A--M--D--T--N--Y--Y--Y--S--A--V--E--R--N--N--L--M--R--L
CTGAAGAAGGAACATTAAATGGTCTCACTTCTCCATTTAAGCCAGCTATGGATACAAATTACTATTATTCAGCTGTGGAAAGAAATAACTTGATGAGGTT
                       ::..:::::::::::::::: :.:::::::::::::::::::::.:::   ::::::::::::::::::::::::::
-----------------------CTTGCTTCTCCATTTAAGCCTGTTATGGATACAAATTACTATTACTCA---GTGGAAAGAAATAACTTGATGAGGTT
------------------------L--A--S--P--F--K--P--V--M--D--T--N--Y--Y--Y--S-----V--E--R--N--N--L--M--R--L

-------------------------------------><-------------------------------------------------------------
--S--Q--S--I--P--F--T--P--V--P--P--R--G--E--P--V--T--V--Y--R--L--E--E--S--S--P--N--I--L--N--N--S--M-
ATCACAGAGCATTCCATTTACACCTGTGCCTCCAAGAGGGGAGCCTGTCACAGTGTATCGTTTGGAAGAGAGTTCACCCAACATACTAAATAACAGCATG
::: :::::::::::::::::::::::::::::::::   ::::::::::::::::::::.:::::.:::::::: :::::::::::.::::::::::::
ATCCCAGAGCATTCCATTTACACCTGTGCCTCCAAGA---GAGCCTGTCACAGTGTATCGCTTGGAGGAGAGTTCTCCCAACATACTGAATAACAGCATG
--S--Q--S--I--P--F--T--P--V--P--P--R-----E--P--V--T--V--Y--R--L--E--E--S--S--P--N--I--L--N--N--S--M-

----------------------------------------------------------------------------------------------------
-S--S--W--S--Q--L--G--L--C--A--K--I--E--F--L--S--K--E--E--M--G--G--G--L--R--R--A--V--K--V--Q--C--T--
TCTTCTTGGTCACAACTAGGCCTCTGTGCCAAAATAGAGTTTTTAAGCAAAGAGGAGATGGGAGGAGGTTTACGAAGAGCTGTCAAAGTACAGTGTACCT
::::::::::::::.::::::::.:::::::::::::::::::::::.::::::::::::::::::::::::::::::::::::::::::::::::::.:
TCTTCTTGGTCACAGCTAGGCCTTTGTGCCAAAATAGAGTTTTTAAGTAAAGAGGAGATGGGAGGAGGTTTACGAAGAGCTGTCAAAGTACAGTGTACTT
-S--S--W--S--Q--L--G--L--C--A--K--I--E--F--L--S--K--E--E--M--G--G--G--L--R--R--A--V--K--V--Q--C--T--

----------------------------------------------------------------------------------------------------
W--S--E--H--D--I--L--K--S--G--H--L--Y--I--I--K--S--F--L--P--E--V--V--N--T--W--S--S--I--Y--K--E--D--T
GGTCAGAACATGATATCCTCAAATCAGGGCATCTTTATATTATCAAATCTTTTCTTCCAGAGGTGGTTAATACATGGTCAAGTATTTACAAAGAAGATAC
:::::::.::::::::::::::::::::.:::::::::::.::::::::::::::::: :::::::::::.:::::::::::::::::.:::::::::::
GGTCAGAGCATGATATCCTCAAATCAGGACATCTTTATATCATCAAATCTTTTCTTCCTGAGGTGGTTAACACATGGTCAAGTATTTATAAAGAAGATAC
W--S--E--H--D--I--L--K--S--G--H--L--Y--I--I--K--S--F--L--P--E--V--V--N--T--W--S--S--I--Y--K--E--D--T

---------------------><-----------------------------------------------------------------------------
--V--L--H--L--C--L--R--E--I--Q--Q--Q--R--A--A--Q--K--L--T--F--A--F--N--Q--M--K--P--K--S--I--P--Y--S-
AGTTCTGCATCTCTGTCTGAGAGAAATTCAACAACAGAGAGCAGCACAAAAGCTTACGTTTGCCTTTAATCAAATGAAACCCAAATCCATACCATATTCT
:::::::::::::::::: ::::::::::::::::::::::::::::::::::::::.::::::::.::.::::::::::::::::::::::::::::::
AGTTCTGCATCTCTGTCTCAGAGAAATTCAACAACAGAGAGCAGCACAAAAGCTTACATTTGCCTTCAACCAAATGAAACCCAAATCCATACCATATTCT
--V--L--H--L--C--L--R--E--I--Q--Q--Q--R--A--A--Q--K--L--T--F--A--F--N--Q--M--K--P--K--S--I--P--Y--S-

----><----------------------------------------------------------------------------------------------
-P--R--F--L--E--V--F--L--L--Y--C--H--S--A--G--Q--W--F--A--V--E--E--C--M--T--G--E--F--R--K--Y--N--N--
CCAAGGTTCCTTGAAGTTTTCCTGCTGTATTGCCATTCAGCAGGACAGTGGTTTGCTGTGGAAGAATGTATGACTGGAGAATTTAGAAAATACAACAATA
:::   ::::::::::::::::::::.::::::::.::::::::::::::::::::::::::::::::::::::::::::::::::.:::::::::::.:
CCA---TTCCTTGAAGTTTTCCTGCTATATTGCCACTCAGCAGGACAGTGGTTTGCTGTGGAAGAATGTATGACTGGAGAATTTAGGAAATACAACAACA
-P-----F--L--E--V--F--L--L--Y--C--H--S--A--G--Q--W--F--A--V--E--E--C--M--T--G--E--F--R--K--Y--N--N--

----------------------------------------------------------------------------------------------------
N--N--G--D--E--I--I--P--T--N--T--L--E--E--I--M--L--A--F--S--H--W--T--Y--E--Y--T--R--G--E--L--L--V--L
ATAATGGAGATGAGATTATTCCAACTAATACTCTGGAAGAGATCATGCTAGCCTTTAGCCACTGGACTTACGAATATACAAGAGGGGAGTTACTGGTACT
::::::: ::::::::::::::::::::::: ::::::::::::::::::::::::::::::::::::::.::::::::::::::.::::::::::::::
ATAATGGTGATGAGATTATTCCAACTAATACACTGGAAGAGATCATGCTAGCCTTTAGCCACTGGACTTATGAATATACAAGAGGAGAGTTACTGGTACT
N--N--G--D--E--I--I--P--T--N--T--L--E--E--I--M--L--A--F--S--H--W--T--Y--E--Y--T--R--G--E--L--L--V--L

----------><--------------------------------------------------><------------------------------------
--D--L--Q--G--V--G--E--N--L--T--D--P--S--V--I--K--A--E--E--K--R--S--C--D--M--V--F--G--P--A--N--L--G-
TGATTTGCAAGGTGTTGGTGAAAATTTGACTGACCCATCTGTGATAAAAGCAGAAGAAAAGAGATCCTGTGATATGGTTTTTGGCCCAGCAAATCTAGGA
::::::.:::   :: :::::::::::::::::.:: :::::::::::.::::::::::::   ::::::::::::::::::::::::::::::::::::
TGATTTACAA---GTGGGTGAAAATTTGACTGATCCTTCTGTGATAAAGGCAGAAGAAAAG---TCCTGTGATATGGTTTTTGGCCCAGCAAATCTAGGA
--D--L--Q-----V--G--E--N--L--T--D--P--S--V--I--K--A--E--E--K-----S--C--D--M--V--F--G--P--A--N--L--G-

---------------------------------------------------------------------><-----------------------------
-E--D--A--I--K--N--F--R--A--K--H--H--C--N--S--C--C--R--K--L--K--L--P--D--L--K--R--N--D--Y--T--P--D--
GAAGATGCAATTAAAAACTTCAGAGCAAAACATCACTGTAATTCTTGCTGTAGAAAGCTTAAACTTCCAGATCTGAAGAGGAATGATTATACGCCTGATA
::::::::::: :::::::::::::::::::::::.:::::::::::::::::::::::::::::::::   ::::::::::::::.:::::.:::::::
GAAGATGCAATAAAAAACTTCAGAGCAAAACATCATTGTAATTCTTGCTGTAGAAAGCTTAAACTTCCA---CTGAAGAGGAATGACTATACACCTGATA
-E--D--A--I--K--N--F--R--A--K--H--H--C--N--S--C--C--R--K--L--K--L--P-----L--K--R--N--D--Y--T--P--D--

----------------------------------------------------------------------------------------------------
K--I--I--F--P--Q--D--E--P--S--D--L--N--L--Q--P--G--N--S--T--K--E--S--E--S--T--N--S--V--R--L--M--L--*
AAATTATATTTCCTCAGGATGAGCCTTCAGATTTGAATCTTCAGCCTGGAAATTCCACCAAAGAATCAGAATCAACTAATTCTGTTCGTCTGATGTTATA
::.:::::::::::::::::::.::::: ::::::                                                                 
AAGTTATATTTCCTCAGGATGAACCTTCTGATTTG-----------------------------------------------------------------
K--V--I--F--P--Q--D--E--P--S--D--L------------------------------------------------------------------

>
-
A
 
-
-

Pig Consensus Sequence

>BGISUST0000886207
---TCCCAGAAATCCTGGATAGAAAGCACTTTGACCAAGAGGGAATGTGTGTATATTATACCGAGTTCCAAAGACCCTCAC---TGCCTTCCAGGATGTC
AAATTTGTCAGCAACTCGTC---TGTTTTTGTGGTCGCTTGGTCAAGCAACATGCTTGTTTTACCGCAAGTCTTGCCATGAAATACTCAGATGTGAAATT
GGGTGACCATTTTAATCAGACATTAGAAGAGTGGTCTGTGGAAAAGCATACAGAACAGAGCCCAACGGATGCTTATGGAGTCATAAATTTTCAAGGGGGT
TCTCATTCCTACAGAGCAAAGTATGTGCGGCTATCATATGACACCAAACCTGAAGTCATTCTACAACTTCTGTTGAAAGAATGGCAAATGGAATTACCCA
AACTTGTTATCTCTGTACACGGTGGCATGCAGAAATTTGAGCTTCACCCACGAATTAAACAGTTGCTTGGAAAGGGTCTTATCAAAGCTGCAGTTACAAC
TGGAGCTTGGATTTTAACTGGAGGAGTAAACACA---GTGGCAAAACATGTTGGTGATGCCCTTAAAGAACATGCTTCCAGATCATCTCGAAAGATTTGC
ACCATCGGAATAGCTCCGTGGGGAGTGATTGAAAACAGAAATGATCTTGTTGGGAGAGATGTGGTTGCTCCTTACCAAACGTTATTGAACCCTCTGAGCA
AATTGAATGTTCTGAATAATCTACATTCCCATTTCATATTGGTGGATGATGGCACTGTTGGAAAGTATGGGGCAGAAGTCAGACTAAGAAGAGAACTTGA
AAAAACTATTAATCAGCAAAGAATTCATGCT---ATTGGTCAAGGTGTCCCTGTGGTGGCACTTATATTTGAAGGCGGGCCAAATGTTATCCTCACAGTT
TTAGAATACCTTCAGGAAAGTCCTCCTGTTCCAGTTGTCGTATGTGAAGGAACAGGGAGAGCTGCAGATCTACTAGCATATCTTCATAAACAAACAGAAG
AA------AATCTTCCTGATGCAGCAGAGCCAGATATTATTTCAACCATCAAAAAaaCTTTTAACTTTGGCCAAAGTGAAGCAGTTCATTTATTTCAGAC
ACTGATGGAGTGTATGAAAAGAAAGGAGCTTATTACTGTTTTCCACATTGGATCAGATGAACATCAAGATATAGATGTAGCAATACTAACTGCACTGCTT
AAA-------------------------------------------------------------------------------------------------
-----GTTGGATCCTTGGAACAAGCTATGCTCGATGCTCTTGTAATGGATAGAGTTGCATTTGTAAAACTTCTTATTGAAAATGGAGTAAGCATGCATAA
ATTCCTTACCATTCCTAGACTGGAAGAACTTTACAACACT------------------------------------------------------GGAAAT
CTTCCTCCAGGATATAAGATCACTCTAATCGATATAGGACTTGTTATTGAATATCTCATGGGAGGAACCTATAGATGCACCTATACTCGGAAACGTTTTC
GACTGATATATAACAGCCTTGGTGGGAATAGTCGG------------AATACCTCCAGCAGCACTCCTCAGTTGAGAAAGAGTCAAGAATCTTTTGNCAA
TAGAGCAGATAAAAAGGAAAAAATGAGACATAATCATTTCATTAAAACAGCACAGCCCTACCGACCNAAGATTGATACAACAGTGGAAGAAGGAAAGAAG
AAAAGAACCAAAGATGAAATTGTAGATATTGATGATCCAGAAACCAAGCGCTTTCCTTATCCACTTAATGAACTGTTAATTTGGGCTTGCCTTATGAAGA
GGCAGGTCATGGCCCGTTTTCTATGGCAGCATGGTGAAGAATCAATGGCTAAAGCGTTAGTTGCCTGTAAGATCTATCGTTCAATGGCATATGAAGCAAA
GCAGAGTGACCTTGTAGATGATACTTCAGAGGAATTGAAACAGTATTCC---------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
---------ATCTTTATGTCTGAAGCTGGAAAAATAAGCCAGAAGATTAAAGTGTGGTTTAGTGATTACTTCAATATCAGTGATACNATTGCCATAATTT
CTTTCTTCATTGGATTTGGACTAAGATTTGGAGCNAAATGGAACTTTGAGAATGCATATGATAATCATGTTTTTGTGGCTGGAAGATTAATTTACTGTCT
TAACATAATATTTTGGTATGTGCGTTTGCTAGATTTTCTAGCTGTAAATCAACAGGCAGGACCTTATGTAATGATGATTGGAAAAATGGTGGCCAATATG
TTNTACATTGTAGTGATTATGGCTCTTGTATTACTTAGTTTTGGTGTTCCTAGAAAGGCAATACTTTATCCTCATGAAGCACCATCTTGGACTCTTGCTA
AAGATATAGTTTTTCATCCATACTGGATGATTTTCGGTGAAGTTTATGCATATGAAATTGAT---TGTGCAAATGATTCATCTATTCGTGAAATCTGTGG
TCCTGGGACATGGTTGACTCCATTTCTTCAAGCAGTCTACCTCTTTGTACAGTATATCATTATGGTCAATCTTCTCATTGCATTTTTC---AATGTATAT
TTACAAGTGAAGGCAATTTCTAATATTGTATGGAAATACCAACGTTATCATTTTATTATGGCTTATCATGAGAAACCAGTTTTGCCTCCACCACTTATCA
TTCTCAGCCATATAGTTTCTCTGTTTTGCTGCATATGTAAAAGAAGGAAAAAAGATAAGACTTCAGATGGGCCA---CTTTTTTTAACAGAAGAAGATCA
AAAGAAACTTCATGATTTTGAAGAGCAGTGTGTTGAGATGTATTTTAATGAAAAAGATGACAAATTCCATTCTGGTAGCGAAGAGAGAATTCGTGTCACT
TTTGAA---GTGGAGCAGATGTGCATTCAGATTAAAGAAGTTGGAGATCGTGTCAACTATATCAAAAGATCGTTACAGTCATTAGATTCTCAAATTGGCC
ATTTGCAAGATCTTTCAGCCCTGACCGTAGATACCTTAAAAACACTTACTGCCCAGAAAGCTTCAGAAGCTAGCAAAGTTCACAATGAAATTACACGAGA
ATTGAGCGTTTCTAAACATTTGGCTCAAAACCTTATTGATGATGGTCCCATAAGACCTTCTGTATGGAAAAAGCACAGTGTTGTAAATACACTTAGCTCC
TCTCTTCCGCAAAGTGGTCTTGAAAGTAATAATCCATTTCTTTGTAATATTTTTATGAAAGATGAAAAAGATCCCCAATGTAATATATTTGGTCAGGATT
TACCTGTAATACCCCGAAAA--------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
--------------------------CACAGAGATAGCATGGATTTACAGAGGTTTAAAGAAACACCAAACAAGATAAAA---------AATGATATTCC
TTCTAAAAACACTTTGAAACACGTGAGTCCTCATGCTGGATTTACTGAGTGTCACAAAACTTCTGTTCCTCTTCACTCAGAACAA---GAAAGTAGCAGT
AGAAGGCTATCTACAGAAGAAACTCATGAAGTAGATTCCAAAGCAGCTTTACTACCG-------------------------------------------
--------------------CTTGCTTCTCCATTTAAGCCTGTTATGGATACAAATTACTATTACTCA---GTGGAAAGAAATAACTTGATGAGGTTATC
CCAGAGCATTCCATTTACACCTGTGCCTCCAAGA---GAGCCTGTCACAGTGTATCGCTTGGAGGAGAGTTCTCCCAACATACTGAATAACAGCATGTCT
TCTTGGTCACAGCTAGGCCTTTGTGCCAAAATAGAGTTTTTAAGTAAAGAGGAGATGGGAGGAGGTTTACGAAGAGCTGTCAAAGTACAGTGTACTTGGT
CAGAGCATGATATCCTCAAATCAGGACATCTTTATATCATCAAATCTTTTCTTCCTGAGGTGGTTAACACATGGTCAAGTATTTATAAAGAAGATACAGT
TCTGCATCTCTGTCTCAGAGAAATTCAACAACAGAGAGCAGCACAAAAGCTTACATTTGCCTTCAACCAAATGAAACCCAAATCCATACCATATTCTCCA
---TTCCTTGAAGTTTTCCTGCTATATTGCCACTCAGCAGGACAGTGGTTTGCTGTGGAAGAATGTATGACTGGAGAATTTAGGAAATACAACAACAATA
ATGGTGATGAGATTATTCCAACTAATACACTGGAAGAGATCATGCTAGCCTTTAGCCACTGGACTTATGAATATACAAGAGGAGAGTTACTGGTACTTGA
TTTACAA---GTGGGTGAAAATTTGACTGATCCTTCTGTGATAAAGGCAGAAGAAAAG---TCCTGTGATATGGTTTTTGGCCCAGCAAATCTAGGAGAA
GATGCAATAAAAAACTTCAGAGCAAAACATCATTGTAATTCTTGCTGTAGAAAGCTTAAACTTCCA---CTGAAGAGGAATGACTATACACCTGATAAAG
TTATATTTCCTCAGGATGAACCTTCTGATTTG------------------------------------------------------------------


>BGISUSP0000886207
-SQKSWIESTLTKRECVYIIPSSKDPH-CLPGCQICQQLV-CFCGRLVKQHACFTASLAMKYSDVKLGDHFNQTLEEWSVEKHTEQSPTDAYGVINFQGG
SHSYRAKYVRLSYDTKPEVILQLLLKEWQMELPKLVISVHGGMQKFELHPRIKQLLGKGLIKAAVTTGAWILTGGVNT-VAKHVGDALKEHASRSSRKIC
TIGIAPWGVIENRNDLVGRDVVAPYQTLLNPLSKLNVLNNLHSHFILVDDGTVGKYGAEVRLRRELEKTINQQRIHA-IGQGVPVVALIFEGGPNVILTV
LEYLQESPPVPVVVCEGTGRAADLLAYLHKQTEE--NLPDAAEPDIISTIKKTFNFGQSEAVHLFQTLMECMKRKELITVFHIGSDEHQDIDVAILTALL
K----------------------------------VGSLEQAMLDALVMDRVAFVKLLIENGVSMHKFLTIPRLEELYNT------------------GN
LPPGYKITLIDIGLVIEYLMGGTYRCTYTRKRFRLIYNSLGGNSR----NTSSSTPQLRKSQESF-NRADKKEKMRHNHFIKTAQPYR-KIDTTVEEGKK
KRTKDEIVDIDDPETKRFPYPLNELLIWACLMKRQVMARFLWQHGEESMAKALVACKIYRSMAYEAKQSDLVDDTSEELKQYS-----------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
---IFMSEAGKISQKIKVWFSDYFNISD-IAIISFFIGFGLRFG-KWNFENAYDNHVFVAGRLIYCLNIIFWYVRLLDFLAVNQQAGPYVMMIGKMVANM
-YIVVIMALVLLSFGVPRKAILYPHEAPSWTLAKDIVFHPYWMIFGEVYAYEID-CANDSSIREICGPGTWLTPFLQAVYLFVQYIIMVNLLIAFF-NVY
LQVKAISNIVWKYQRYHFIMAYHEKPVLPPPLIILSHIVSLFCCICKRRKKDKTSDGP-LFLTEEDQKKLHDFEEQCVEMYFNEKDDKFHSGSEERIRVT
FE-VEQMCIQIKEVGDRVNYIKRSLQSLDSQIGHLQDLSALTVDTLKTLTAQKASEASKVHNEITRELSVSKHLAQNLIDDGPIRPSVWKKHSVVNTLSS
SLPQSGLESNNPFLCNIFMKDEKDPQCNIFGQDLPVIPRK------------------------------------------------------------
------------------------------------------HRDSMDLQRFKETPNKIK---NDIPSKNTLKHVSPHAGFTECHKTSVPLHSEQ-ESSS
RRLSTEETHEVDSKAALLP---------------------LASPFKPVMDTNYYYS-VERNNLMRLSQSIPFTPVPPR-EPVTVYRLEESSPNILNNSMS
SWSQLGLCAKIEFLSKEEMGGGLRRAVKVQCTWSEHDILKSGHLYIIKSFLPEVVNTWSSIYKEDTVLHLCLREIQQQRAAQKLTFAFNQMKPKSIPYSP
-FLEVFLLYCHSAGQWFAVEECMTGEFRKYNNNNGDEIIPTNTLEEIMLAFSHWTYEYTRGELLVLDLQ-VGENLTDPSVIKAEEK-SCDMVFGPANLGE
DAIKNFRAKHHCNSCCRKLKLP-LKRNDYTPDKVIFPQDEPSDL----------------------