Sequences
EST Library Info
cad2Unavailable
cov5Ovary - RNA from China
csp2Spleen - RNA from China
ecc2Foetus 50 days, cortex cerebri
eep2Foetus 50 days, epidermis
eje8Foetus 50 days, jejunum
eye3Foetus 50 days, Eye
jej1Small intestine, jejunum
nbm1Newborn 115 days, bone marrow (pelvis)
nco2Newborn 115 days, colon
nep1Newborn 115 days, epidermis
nms5Newborn 115 days, M. semitendinosus
pgl2Pituitary gland
plac5Unavailable
ton1Tip of tongue, mucosal membrane
ute2Uterus
Clusters
Oligos
SNPs

Gene ID ENSG00000178952 (click for geneview)
Transcript ID ENST00000313511(link to ensembl)
Symbol TUFM
Localtion Chromosome:16:28761615:28765144:-1 band: 16p11.2
Description Elongation factor Tu, mitochondrial precursor (EF-Tu) (P43). [Source:Uniprot/SWISSPROT;Acc:P49411]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<--------------------------------------------------><-----------------------------------------------
-M--T--T--M--A--A--A--T--L--L--R--A--T--P--H--F--S--G--L--A--A--G--R--T--F--L--L--Q--G--L--L--R--L--
ATGACCACAATGGCGGCCGCCACCCTGCTGCGCGCGACGCCCCACTTCAGCGGTCTCGCCGCCGGCCGGACCTTCCTGCTGCAGGGTCTGTTGCGGCTGC
   :::::::::::::::::::::::::::::::::::::::: :::::::   :::: :::.:::: .:: :. :::.::::::::::::::::::.::
---ACCACAATGGCGGCCGCCACCCTGCTGCGCGCGACGCCCCTCTTCAGC---CTCGGCGCTGGCCCAACATCACTGTTGCAGGGTCTGTTGCGGCCGC
----T--T--M--A--A--A--T--L--L--R--A--T--P--L--F--S-----L--G--A--G--P--T--S--L--L--Q--G--L--L--R--P--

----------------------------------------------------------------------------------------------------
L--K--A--P--A--L--P--L--L--C--R--G--L--A--V--E--A--K--K--T--Y--V--R--D--K--P--H--V--N--V--G--T--I--G
TGAAAGCCCCGGCATTGCCTCTCTTGTGCCGCGGCCTGGCCGTGGAGGCCAAGAAGACTTACGTGCGCGACAAGCCACATGTGAATGTGGGTACCATCGG
::::.:::::::::.::::.::::::::::::::::::::::::::::::::::::::.::.:::::::::::::: ::::::::.::::::::::::::
TGAAGGCCCCGGCACTGCCCCTCTTGTGCCGCGGCCTGGCCGTGGAGGCCAAGAAGACCTATGTGCGCGACAAGCCCCATGTGAACGTGGGTACCATCGG
L--K--A--P--A--L--P--L--L--C--R--G--L--A--V--E--A--K--K--T--Y--V--R--D--K--P--H--V--N--V--G--T--I--G

----------------------------------------------><----------------------------------------------------
--H--V--D--H--G--K--T--T--L--T--A--A--I--T--K--I--L--A--E--G--G--G--A--K--F--K--K--Y--E--E--I--D--N-
CCATGTGGACCACGGGAAGACCACGCTGACTGCAGCCATCACGAAGATTCTAGCTGAGGGAGGTGGGGCTAAGTTCAAGAAGTACGAGGAGATTGACAAT
::::::::::::::: ::::::::.:::::.::::::::::::      .::::.::::::::.:::::.:::::.:::::::::::::::::.:::::.
CCATGTGGACCACGGCAAGACCACACTGACCGCAGCCATCACG------TTAGCCGAGGGAGGCGGGGCCAAGTTTAAGAAGTACGAGGAGATCGACAAC
--H--V--D--H--G--K--T--T--L--T--A--A--I--T--------L--A--E--G--G--G--A--K--F--K--K--Y--E--E--I--D--N-

----------------------------------------------------------------------------------------------------
-A--P--E--E--R--A--R--G--I--T--I--N--A--A--H--V--E--Y--S--T--A--A--R--H--Y--A--H--T--D--C--P--G--H--
GCCCCGGAGGAGCGAGCTCGGGGTATCACCATCAATGCGGCTCATGTGGAGTATAGCACTGCCGCCCGCCACTACGCCCACACAGACTGCCCGGGTCATG
:::::.:::::::::::.::.:: :::::::::::::::::.::.::::::::.:::::::::. :::::::::.::::::::::::::::: :::::.:
GCCCCAGAGGAGCGAGCCCGAGGGATCACCATCAATGCGGCCCACGTGGAGTACAGCACTGCCAACCGCCACTATGCCCACACAGACTGCCCCGGTCACG
-A--P--E--E--R--A--R--G--I--T--I--N--A--A--H--V--E--Y--S--T--A--N--R--H--Y--A--H--T--D--C--P--G--H--

-------------><-------------------------------------------------------------------------------------
A--D--Y--V--K--N--M--I--T--G--T--A--P--L--D--G--C--I--L--V--V--A--A--N--D--G--P--M--P--Q--T--R--E--H
CAGATTATGTTAAGAATATGATCACAGGCACTGCACCCCTCGACGGCTGCATCCTGGTGGTAGCAGCCAATGACGGCCCCATGCCCCAGACCCGAGAGCA
:::::::.::::::::::::::::::::.::::: :: :: :::::::::::::::::::::::::::::.::::::::::::::::::::::::::.::
CAGATTACGTTAAGAATATGATCACAGGTACTGCCCCGCTGGACGGCTGCATCCTGGTGGTAGCAGCCAACGACGGCCCCATGCCCCAGACCCGAGAACA
A--D--Y--V--K--N--M--I--T--G--T--A--P--L--D--G--C--I--L--V--V--A--A--N--D--G--P--M--P--Q--T--R--E--H

------------------><--------------------------------------------------------------------------------
--L--L--L--A--R--Q--I--G--V--E--H--V--V--V--Y--V--N--K--A--D--A--V--Q--D--S--E--M--V--E--L--V--E--L-
CTTATTACTGGCCAGACAGATTGGGGTGGAGCATGTGGTGGTGTATGTGAACAAGGCTGACGCTGTCCAGGACTCTGAGATGGTGGAACTGGTGGAACTG
::::.:::::::::..::::::::.::::::::.:::::::::::::::::.::::: :::::.::.::::::::::::::::::::.::::: ::.:::
CTTACTACTGGCCAAGCAGATTGGAGTGGAGCACGTGGTGGTGTATGTGAATAAGGCGGACGCCGTTCAGGACTCTGAGATGGTGGAGCTGGTCGAGCTG
--L--L--L--A--K--Q--I--G--V--E--H--V--V--V--Y--V--N--K--A--D--A--V--Q--D--S--E--M--V--E--L--V--E--L-

-----------------------------------------------------------------------------------><---------------
-E--I--R--E--L--L--T--E--F--G--Y--K--G--E--E--T--P--V--I--V--G--S--A--L--C--A--L--E--G--R--D--P--E--
GAGATCCGGGAGCTGCTCACCGAGTTTGGCTATAAAGGGGAGGAGACCCCAGTCATCGTAGGCTCTGCTCTCTGTGCCCTTGAGGGTCGGGACCCTGAGT
:::::: ::::.:::::::: :::::::::::.::::::::::::::.::..:::::::.::::::::.:::::::::::::::   :: ::::::::::
GAGATCAGGGAACTGCTCACAGAGTTTGGCTACAAAGGGGAGGAGACTCCGATCATCGTGGGCTCTGCCCTCTGTGCCCTTGAG---CGTGACCCTGAGT
-E--I--R--E--L--L--T--E--F--G--Y--K--G--E--E--T--P--I--I--V--G--S--A--L--C--A--L--E-----R--D--P--E--

----------------------------------------------------------------------------------------------------
L--G--L--K--S--V--Q--K--L--L--D--A--V--D--T--Y--I--P--V--P--A--R--D--L--E--K--P--F--L--L--P--V--E--A
TAGGCCTGAAGTCTGTGCAGAAGCTACTGGATGCTGTGGACACTTACATCCCAGTGCCCGCCCGGGACCTGGAGAAGCCTTTCCTGCTGCCTGTGGAGGC
:::::::::::::::::::::::::.::::::::::::::::::::.::::::::::::.:::::::::::::::::::::::::::::::::::::: :
TAGGCCTGAAGTCTGTGCAGAAGCTGCTGGATGCTGTGGACACTTATATCCCAGTGCCCACCCGGGACCTGGAGAAGCCTTTCCTGCTGCCTGTGGAGTC
L--G--L--K--S--V--Q--K--L--L--D--A--V--D--T--Y--I--P--V--P--T--R--D--L--E--K--P--F--L--L--P--V--E--S

----------------><----------------------------------------------------------------------------------
--V--Y--S--V--P--G--R--G--T--V--V--T--G--T--L--E--R--G--I--L--K--K--G--D--E--C--E--L--L--G--H--S--K-
GGTGTACTCCGTCCCTGGCCGTGGCACCGTGGTGACAGGTACACTAGAGCGTGGCATTTTAAAGAAGGGAGACGAGTGTGAGCTCCTAGGACATAGCAAG
 ::::::::..:::::   :: ::::: :::::::::::.::.:: ::::::::.:::::.:::::::::::.:::::.:::.::::.::::::::::::
TGTGTACTCTATCCCT---CGAGGCACGGTGGTGACAGGCACGCTCGAGCGTGGTATTTTGAAGAAGGGAGATGAGTGCGAGTTCCTGGGACATAGCAAG
--V--Y--S--I--P-----R--G--T--V--V--T--G--T--L--E--R--G--I--L--K--K--G--D--E--C--E--F--L--G--H--S--K-

---------------------><-----------------------------------------------------------------------------
-N--I--R--T--V--V--T--G--I--E--M--F--H--K--S--L--E--R--A--E--A--G--D--N--L--G--A--L--V--R--G--L--K--
AACATCCGCACTGTGGTGACAGGCATTGAGATGTTCCACAAGAGCCTGGAGAGGGCCGAGGCCGGAGATAACCTCGGGGCCCTGGTCCGAGGCTTGAAGC
::.::.:::::::::::::::   :::::::::::::::::::::::::::::::: :::::::: ::.::::: :::::::::::::::::::::::::
AATATTCGCACTGTGGTGACA---ATTGAGATGTTCCACAAGAGCCTGGAGAGGGCGGAGGCCGGCGACAACCTGGGGGCCCTGGTCCGAGGCTTGAAGC
-N--I--R--T--V--V--T-----I--E--M--F--H--K--S--L--E--R--A--E--A--G--D--N--L--G--A--L--V--R--G--L--K--

-------------------------------------------------------------------------><-------------------------
R--E--D--L--R--R--G--L--V--M--V--K--P--G--S--I--K--P--H--Q--K--V--E--A--Q--V--Y--I--L--S--K--E--E--G
GGGAGGACTTGCGGCGGGGCCTGGTCATGGTCAAGCCAGGTTCCATCAAGCCCCACCAGAAGGTGGAGGCCCAGGTTTACATCCTCAGCAAGGAGGAAGG
::::::::.:: :::: :::::::::::::.::::::.::::::::: :: ::::::::::::::::.:: ::::::::::::::::::::::::::.::
GGGAGGACCTGAGGCGTGGCCTGGTCATGGCCAAGCCGGGTTCCATCCAGACCCACCAGAAGGTGGAAGCGCAGGTTTACATCCTCAGCAAGGAGGAGGG
R--E--D--L--R--R--G--L--V--M--A--K--P--G--S--I--Q--T--H--Q--K--V--E--A--Q--V--Y--I--L--S--K--E--E--G

---------------------------------------------------------------------------------------------><-----
--G--R--H--K--P--F--V--S--H--F--M--P--V--M--F--S--L--T--W--D--M--A--C--R--I--I--L--P--P--E--K--E--L-
TGGCCGCCACAAGCCCTTTGTGTCCCACTTCATGCCTGTCATGTTCTCCCTGACTTGGGACATGGCCTGTCGGATTATCCTGCCCCCAGAGAAGGAGCTT
:::::::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::::::::::::.:::.:::: : .:.:::::::::.
TGGCCGCCACAAGCCCTTTGTGTCCCATTTCATGCCTGTCATGTTCTCCCTGACTTGGGACATGGCCTGTCGGATCATCTTGCCACAGGGGAAGGAGCTC
--G--R--H--K--P--F--V--S--H--F--M--P--V--M--F--S--L--T--W--D--M--A--C--R--I--I--L--P--Q--G--K--E--L-

----------------------------------------------------------------------------------------------------
-A--M--P--G--E--D--L--K--F--N--L--I--L--R--Q--P--M--I--L--E--K--G--Q--R--F--T--L--R--D--G--N--R--T--
GCCATGCCCGGGGAGGACCTGAAGTTCAACCTAATCTTGCGGCAGCCAATGATCTTAGAGAAAGGCCAGCGTTTCACCCTGCGAGATGGCAACCGGACTA
::::::::::::::::::::::::.::: ::: ::::::::::::::::::::::::::.::::::::::::::::::::: :.::.:::::::::::.:
GCCATGCCCGGGGAGGACCTGAAGCTCACCCTCATCTTGCGGCAGCCAATGATCTTAGAAAAAGGCCAGCGTTTCACCCTGAGGGACGGCAACCGGACCA
-A--M--P--G--E--D--L--K--L--T--L--I--L--R--Q--P--M--I--L--E--K--G--Q--R--F--T--L--R--D--G--N--R--T--

------------------------------------------------------------------->
I--G--T--G--L--V--T--N--T--L--A--M--T--E--E--E--K--N--I--K--W--G--*-
TTGGCACCGGTCTAGTCACCAACACGCTGGCCATGACTGAGGAGGAGAAGAATATCAAATGGGGTTGA
:::::::.::.:: ::::::.::::::.:::::::::.:::::::: :::::.:::::::::.:::::
TTGGCACTGGCCTTGTCACCGACACGCCGGCCATGACCGAGGAGGACAAGAACATCAAATGGAGTTGA
I--G--T--G--L--V--T--D--T--P--A--M--T--E--E--D--K--N--I--K--W--S--*-

Pig Consensus Sequence

>BGISUST0000882187
---ACCACAATGGCGGCCGCCACCCTGCTGCGCGCGACGCCCCTCTTCAGC---CTCGGCGCTGGCCCAACATCACTGTTGCAGGGTCTGTTGCGGCCGC
TGAAGGCCCCGGCACTGCCCCTCTTGTGCCGCGGCCTGGCCGTGGAGGCCAAGAAGACCTATGTGCGCGACAAGCCCCATGTGAACGTGGGTACCATCGG
CCATGTGGACCACGGCAAGACCACACTGACCGCAGCCATCACG------TTAGCCGAGGGAGGCGGGGCCAAGTTTAAGAAGTACGAGGAGATCGACAAC
GCCCCAGAGGAGCGAGCCCGAGGGATCACCATCAATGCGGCCCACGTGGAGTACAGCACTGCCAACCGCCACTATGCCCACACAGACTGCCCCGGTCACG
CAGATTACGTTAAGAATATGATCACAGGTACTGCCCCGCTGGACGGCTGCATCCTGGTGGTAGCAGCCAACGACGGCCCCATGCCCCAGACCCGAGAACA
CTTACTACTGGCCAAGCAGATTGGAGTGGAGCACGTGGTGGTGTATGTGAATAAGGCGGACGCCGTTCAGGACTCTGAGATGGTGGAGCTGGTCGAGCTG
GAGATCAGGGAACTGCTCACAGAGTTTGGCTACAAAGGGGAGGAGACTCCGATCATCGTGGGCTCTGCCCTCTGTGCCCTTGAG---CGTGACCCTGAGT
TAGGCCTGAAGTCTGTGCAGAAGCTGCTGGATGCTGTGGACACTTATATCCCAGTGCCCACCCGGGACCTGGAGAAGCCTTTCCTGCTGCCTGTGGAGTC
TGTGTACTCTATCCCT---CGAGGCACGGTGGTGACAGGCACGCTCGAGCGTGGTATTTTGAAGAAGGGAGATGAGTGCGAGTTCCTGGGACATAGCAAG
AATATTCGCACTGTGGTGACA---ATTGAGATGTTCCACAAGAGCCTGGAGAGGGCGGAGGCCGGCGACAACCTGGGGGCCCTGGTCCGAGGCTTGAAGC
GGGAGGACCTGAGGCGTGGCCTGGTCATGGCCAAGCCGGGTTCCATCCAGACCCACCAGAAGGTGGAAGCGCAGGTTTACATCCTCAGCAAGGAGGAGGG
TGGCCGCCACAAGCCCTTTGTGTCCCATTTCATGCCTGTCATGTTCTCCCTGACTTGGGACATGGCCTGTCGGATCATCTTGCCACAGGGGAAGGAGCTC
GCCATGCCCGGGGAGGACCTGAAGCTCACCCTCATCTTGCGGCAGCCAATGATCTTAGAAAAAGGCCAGCGTTTCACCCTGAGGGACGGCAACCGGACCA
TTGGCACTGGCCTTGTCACCGACACGCCGGCCATGACCGAGGAGGACAAGAACATCAAATGGAGTTGA


>BGISUSP0000882187
-TTMAAATLLRATPLFS-LGAGPTSLLQGLLRPLKAPALPLLCRGLAVEAKKTYVRDKPHVNVGTIGHVDHGKTTLTAAIT--LAEGGGAKFKKYEEIDN
APEERARGITINAAHVEYSTANRHYAHTDCPGHADYVKNMITGTAPLDGCILVVAANDGPMPQTREHLLLAKQIGVEHVVVYVNKADAVQDSEMVELVEL
EIRELLTEFGYKGEETPIIVGSALCALE-RDPELGLKSVQKLLDAVDTYIPVPTRDLEKPFLLPVESVYSIP-RGTVVTGTLERGILKKGDECEFLGHSK
NIRTVVT-IEMFHKSLERAEAGDNLGALVRGLKREDLRRGLVMAKPGSIQTHQKVEAQVYILSKEEGGRHKPFVSHFMPVMFSLTWDMACRIILPQGKEL
AMPGEDLKLTLILRQPMILEKGQRFTLRDGNRTIGTGLVTDTPAMTEEDKNIKWS*