Sequences
EST Library Info
eru3Foetus 50 days, regio umbilicalis
Clusters
Oligos
SNPs

Gene ID ENSG00000177706 (click for geneview)
Transcript ID ENST00000313766(link to ensembl)
Symbol FAM20C
Localtion Chromosome:7:288325:304063:1 band: 7p22.3
Description Protein FAM20C precursor.
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--V--F--L--V--A--C--A--L--H--I--A--L--D--L--L--P--R--L--E--R--R--G--A--R--P--S--G--E--P--G--C--S--
ATGGTGTTCCTGGTGGCCTGCGCGCTGCACATCGCCCTGGACCTGCTGCCCAGGCTGGAGCGACGCGGCGCGCGGCCCTCGGGGGAGCCCGGCTGTTCGT
::::..:::::::::::.::::::::::::::::. ::::::::::::::::.:::.:::::.:::  ::::::::::::::::::.:::::::::::::
ATGGCATTCCTGGTGGCTTGCGCGCTGCACATCGTGCTGGACCTGCTGCCCAAGCTAGAGCGGCGCTCCGCGCGGCCCTCGGGGGAACCCGGCTGTTCGT
-M--A--F--L--V--A--C--A--L--H--I--V--L--D--L--L--P--K--L--E--R--R--S--A--R--P--S--G--E--P--G--C--S--

----------------------------------------------------------------------------------------------------
C--A--Q--P--A--A--E--V--A--A--P--G--W--A--Q--V--R--G--R--P--G--E--P--P--A--A--S--S--A--A--G--D--A--G
GCGCGCAGCCCGCCGCCGAGGTGGCCGCGCCCGGCTGGGCCCAGGTTCGGGGCCGCCCCGGGGAGCCCCCGGCCGCCTCCTCCGCCGCCGGCGACGCGGG
::::::::::.:: :::::.:.::: :: :::::::::::: :::. :: :::::::::: :::::::::::::::  ::::.:::::.: :::::::::
GCGCGCAGCCTGCGGCCGAAGCGGCGGCTCCCGGCTGGGCCAAGGCGCGCGGCCGCCCCGCGGAGCCCCCGGCCGCAGCCTCTGCCGCTGCCGACGCGGG
C--A--Q--P--A--A--E--A--A--A--P--G--W--A--K--A--R--G--R--P--A--E--P--P--A--A--A--S--A--A--A--D--A--G

----------------------------------------------------------------------------------------------------
--W--P--N--K--H--T--L--R--I--L--Q--D--F--S--S--D--P--S--S--N--L--S--S--H--S--L--E--K--L--P--P--A--A-
CTGGCCCAACAAGCACACGCTCCGCATCCTGCAGGACTTCAGCTCCGACCCCTCCTCCAACCTCTCGTCCCACTCGCTGGAGAAACTGCCGCCCGCGGCC
 :::::::::::::::::::: ::.::::::::::::::::::::.:::::.:::::::::::: ::::::::::::: :::::::::::.:::::.:: 
ATGGCCCAACAAGCACACGCTGCGTATCCTGCAGGACTTCAGCTCTGACCCTTCCTCCAACCTCACGTCCCACTCGCTTGAGAAACTGCCACCCGCAGCG
--W--P--N--K--H--T--L--R--I--L--Q--D--F--S--S--D--P--S--S--N--L--T--S--H--S--L--E--K--L--P--P--A--A-

----------------------------------------------------------------------------------------------------
-E--P--A--E--R--A--L--R--G--R--D--P--G--A--L--R--P--H--D--P--A--H--R--P--L--L--R--D--P--G--P--R--R--
GAGCCGGCCGAGCGCGCCTTGCGGGGGCGGGATCCCGGCGCCCTAAGACCCCACGACCCCGCGCACCGGCCGCTGCTGCGAGACCCCGGCCCGCGTCGGT
::.: ::: ::: ::::: ::: :::::.::::::.:::::::.. ::::::.: :::: :: :::::::: .:::: :::::.::::::::::::: :.
GAACAGGCGGAGGGCGCCGTGCCGGGGCAGGATCCTGGCGCCCCGCGACCCCGCCACCCAGCTCACCGGCCCTTGCTCCGAGATCCCGGCCCGCGTCCGC
-E--Q--A--E--G--A--V--P--G--Q--D--P--G--A--P--R--P--R--H--P--A--H--R--P--L--L--R--D--P--G--P--R--P--

----------------------------------------------------------------------------------------------------
S--E--S--P--P--G--P--G--G--D--A--S--L--L--A--R--L--F--E--H--P--L--Y--R--V--A--V--P--P--L--T--E--E--D
CCGAGTCGCCCCCCGGCCCCGGCGGAGACGCCTCCCTCCTGGCCAGGCTGTTCGAGCACCCGCTTTACCGGGTGGCGGTTCCGCCGCTCACGGAGGAGGA
: : :.:.:::::::: :: .:.::.:::: :::::::.:::::::::::::: :.:::::..: ::::.:::  : .::::::: :: :::::::: ::
CGGCGCCACCCCCCGGGCCGAGTGGGGACGGCTCCCTCTTGGCCAGGCTGTTCCAACACCCATTGTACCAGGTCCCCATTCCGCCCCTAACGGAGGACGA
P--A--P--P--P--G--P--S--G--D--G--S--L--L--A--R--L--F--Q--H--P--L--Y--Q--V--P--I--P--P--L--T--E--D--D

--------------------------------------------------------------------><------------------------------
--V--L--F--N--V--N--S--D--T--R--L--S--P--K--A--A--------E--N--P--D--W--P--H--A--G--A--E--G--A--E--F-
CGTCCTGTTCAATGTGAACAGCGACACCAGGCTCAGCCCCAAAGCGGCG------GAGAACCCGGACTGGCCGCATGCGGGTGCTGAAGGTGCAGAATTC
.::::: :::::.:::::::::::::.::::.:::.::::::.:::::.      ::::::::::::   ::.::.: .::: ::::.:..   .: :::
TGTCCTCTTCAACGTGAACAGCGACATCAGGTTCAACCCCAAGGCGGCAGCAGCGGAGAACCCGGAC---CCACACGAAGGTCCTGAGGAC---AACTTC
--V--L--F--N--V--N--S--D--I--R--F--N--P--K--A--A--A--A--E--N--P--D-----P--H--E--G--P--E--D-----N--F-

----------------------------------------------------------------------------------------------------
-L--S--P--G--E--A--A--V--D--S--Y--P--N--W--L--K--F--H--I--G--I--N--R--Y--E--L--Y--S--R--H--N--P--A--
CTCTCCCCCGGGGAGGCGGCCGTGGACTCCTATCCCAACTGGCTCAAGTTCCACATTGGTATCAACCGGTACGAGCTGTACTCCAGACACAACCCGGCCA
:: .:: : :::::::::::.:.::::::::::::::::::::::::.::::::::.::::::::::::::::::.::::::: :::::::::::.:: .
CTGCCCACGGGGGAGGCGGCTGCGGACTCCTATCCCAACTGGCTCAAATTCCACATCGGTATCAACCGGTACGAGTTGTACTCGAGACACAACCCAGCGG
-L--P--T--G--E--A--A--A--D--S--Y--P--N--W--L--K--F--H--I--G--I--N--R--Y--E--L--Y--S--R--H--N--P--A--

-----------------------------------------------><---------------------------------------------------
I--E--A--L--L--H--D--L--S--S--Q--R--I--T--S--V--A--M--K--S--G--G--T--Q--L--K--L--I--M--T--F--Q--N--Y
TCGAGGCCCTGCTGCACGACCTCAGCTCCCAGAGGATCACCAGCGTGGCCATGAAGTCGGGGGGCACGCAGCTGAAGCTCATCATGACCTTCCAGAATTA
: :::::::::::::..::::::.:: ::::::.:::::::::.      :::::::::::::::::.::::: :::::::::::::: ::::::::.::
TGGAGGCCCTGCTGCGTGACCTCGGCGCCCAGAAGATCACCAGT------ATGAAGTCGGGGGGCACACAGCTCAAGCTCATCATGACGTTCCAGAACTA
V--E--A--L--L--R--D--L--G--A--Q--K--I--T--S--------M--K--S--G--G--T--Q--L--K--L--I--M--T--F--Q--N--Y

------------------------------>
--G--Q--A--L--F--K--P--M--K--*-
CGGGCAAGCGCTGTTCAAACCCATGAAGTAA
:                              
C------------------------------
-------------------------------

Pig Consensus Sequence

>BGISUST0000893818
ATGGCATTCCTGGTGGCTTGCGCGCTGCACATCGTGCTGGACCTGCTGCCCAAGCTAGAGCGGCGCTCCGCGCGGCCCTCGGGGGAACCCGGCTGTTCGT
GCGCGCAGCCTGCGGCCGAAGCGGCGGCTCCCGGCTGGGCCAAGGCGCGCGGCCGCCCCGCGGAGCCCCCGGCCGCAGCCTCTGCCGCTGCCGACGCGGG
ATGGCCCAACAAGCACACGCTGCGTATCCTGCAGGACTTCAGCTCTGACCCTTCCTCCAACCTCACGTCCCACTCGCTTGAGAAACTGCCACCCGCAGCG
GAACAGGCGGAGGGCGCCGTGCCGGGGCAGGATCCTGGCGCCCCGCGACCCCGCCACCCAGCTCACCGGCCCTTGCTCCGAGATCCCGGCCCGCGTCCGC
CGGCGCCACCCCCCGGGCCGAGTGGGGACGGCTCCCTCTTGGCCAGGCTGTTCCAACACCCATTGTACCAGGTCCCCATTCCGCCCCTAACGGAGGACGA
TGTCCTCTTCAACGTGAACAGCGACATCAGGTTCAACCCCAAGGCGGCAGCAGCGGAGAAC---CCACACGAAGGTCCTGAGGACAACTTCCTGCCCACG
GGGGAGGCGGCTGCGGACTCCTATCCCAACTGGCTCAAATTCCACATCGGTATCAACCGGTACGAGTTGTACTCGAGACACAACCCAGCGGTGGAGGCCC
TGCTGCGTGACCTCGGCGCCCAGAAGATCACCAGT------ATGAAGTCGGGGGGCACACAGCTCAAGCTCATCATGACGTTCCAGAACTAC--------
----------------------


>BGISUSP0000893818
MAFLVACALHIVLDLLPKLERRSARPSGEPGCSCAQPAAEAAAPGWAKARGRPAEPPAAASAAADAGWPNKHTLRILQDFSSDPSSNLTSHSLEKLPPAA
EQAEGAVPGQDPGAPRPRHPAHRPLLRDPGPRPPAPPPGPSGDGSLLARLFQHPLYQVPIPPLTEDDVLFNVNSDIRFNPKAAAAEN-PHEGPEDNFLPT
GEAAADSYPNWLKFHIGINRYELYSRHNPAVEALLRDLGAQKITS--MKSGGTQLKLIMTFQNY----------