Sequences
EST Library Info
ebs3Foetus 50 days, brain stem
hlv1Heart, left ventricle
jca2Joint capsule
nep2Newborn 115 days, epidermis
pigca2Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000103496 (click for geneview)
Transcript ID ENST00000313843(link to ensembl)
Symbol STX4A
Localtion Chromosome:16:30952404:30958985:1 band: 16p11.2
Description Syntaxin-4. [Source:Uniprot/SWISSPROT;Acc:Q12846]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<----------------------------><---------------------------------------------------------------------
-M--R--D--R--T--H--E--L--R--Q--G--D--D--S--S--D--E--E--D--K--E--R--V--A--L--V--V--H--P--G--T--A--R--
ATGCGGGACAGGACCCACGAGCTGAGACAGGGGGATGACAGCTCGGACGAAGAGGACAAGGAGCGGGTCGCGCTGGTGGTGCACCCGGGCACGGCACGGC
                              ::.::::::::::: ::::: :::::::::::: ::::::::::::::::.:::::::::::::::::::
------------------------------GGAGATGACAGCTCTGACGATGAGGACAAGGAGAGGGTCGCGCTGGTGGTACACCCGGGCACGGCACGGC
-------------------------------G--D--D--S--S--D--D--E--D--K--E--R--V--A--L--V--V--H--P--G--T--A--R--

-------------------------------><-------------------------------------------------------------------
L--G--S--P--D--E--E--F--F--H--K--V--R--T--I--R--Q--T--I--V--K--L--G--N--K--V--Q--E--L--E--K--Q--Q--V
TGGGGAGCCCGGACGAGGAGTTCTTCCACAAGGTCCGGACAATTCGGCAGACTATTGTCAAACTGGGGAATAAAGTCCAGGAGTTGGAGAAACAGCAGGT
:::: :::::.::::: ::::::::::: ::::::::::::::::::::::::::::::::.::::.::::::.::::..:::::::::::.::::::::
TGGGCAGCCCAGACGATGAGTTCTTCCAGAAGGTCCGGACAATTCGGCAGACTATTGTCAAGCTGGAGAATAAGGTCCGAGAGTTGGAGAAGCAGCAGGT
L--G--S--P--D--D--E--F--F--Q--K--V--R--T--I--R--Q--T--I--V--K--L--E--N--K--V--R--E--L--E--K--Q--Q--V

-------------------------------><-------------------------------------------------------------------
--T--I--L--A--T--P--L--P--E--E--S--M--K--Q--E--L--Q--N--L--R--D--E--I--K--Q--L--G--R--E--I--R--L--Q-
CACCATCCTGGCCACGCCCCTTCCCGAGGAGAGCATGAAGCAGGAGCTGCAGAACCTGCGCGATGAGATCAAACAGCTGGGGAGGGAGATCCGCCTGCAG
:::::::::::::::::::::::::::::::   ::::::::::: ::::::::::::::.::.::::::::::::::::::::::: :::::: .. ::
CACCATCCTGGCCACGCCCCTTCCCGAGGAG---ATGAAGCAGGACCTGCAGAACCTGCGTGACGAGATCAAACAGCTGGGGAGGGACATCCGCGCAGAG
--T--I--L--A--T--P--L--P--E--E-----M--K--Q--D--L--Q--N--L--R--D--E--I--K--Q--L--G--R--D--I--R--A--E-

------><---------------------------------------------------------------------><---------------------
-L--K--A--I--E--P--Q--K--E--E--A--D--E--N--Y--N--S--V--N--T--R--M--R--K--T--Q--H--G--V--L--S--Q--Q--
CTGAAGGCCATAGAGCCCCAGAAGGAGGAAGCTGATGAGAACTATAACTCCGTCAACACAAGAATGAGAAAAACCCAGCATGGGGTCCTGTCCCAGCAAT
:: :::   :::::::::::::::::::::::.::::::::.:::::::: :::::::::::::::::::::::::::::::: ::::::::::::::::
CTCAAG---ATAGAGCCCCAGAAGGAGGAAGCCGATGAGAATTATAACTCGGTCAACACAAGAATGAGAAAAACCCAGCATGGNGTCCTGTCCCAGCAAT
-L--K-----I--E--P--Q--K--E--E--A--D--E--N--Y--N--S--V--N--T--R--M--R--K--T--Q--H--X--V--L--S--Q--Q--

--------------------------------------------------------------------------------------><------------
F--V--E--L--I--N--K--C--N--S--M--Q--S--E--Y--R--E--K--N--V--E--R--I--R--R--Q--L--K--I--T--N--A--G--M
TCGTGGAGCTCATCAACAAGTGCAATTCAATGCAGTCCGAATACCGGGAGAAGAACGTGGAGCGGATTCGGAGGCAGCTGAAGATCACCAATGCTGGGAT
:::::::::::::::::::::::::.:: :::::::::::.:::::: :::::::::::::::::                        :::::::: ::
TCGTGGAGCTCATCAACAAGTGCAACTCCATGCAGTCCGAGTACCGGTAGAAGAACGTGGAGCGG------------------------AATGCTGGCAT
F--V--E--L--I--N--K--C--N--S--M--Q--S--E--Y--R--*--K--N--V--E--R--------------------------N--A--G--M

---------------------------------------------------------------><-----------------------------------
--V--S--D--E--E--L--E--Q--M--L--D--S--G--Q--S--E--V--F--V--S--N--I--L--K--D--T--Q--V--T--R--Q--A--L-
GGTGTCTGATGAGGAGTTGGAGCAGATGCTGGACAGTGGGCAAAGCGAGGTGTTTGTGTCCAATATCCTGAAGGACACGCAGGTGACTCGACAGGCCTTA
:::::::::.::::::.:::::::::::::::::::.:::::.::::::::::::::::::   :: :::::::::::.:::::::::::::::::..::
GGTGTCTGACGAGGAGCTGGAGCAGATGCTGGACAGCGGGCAGAGCGAGGTGTTTGTGTCC---ATACTGAAGGACACACAGGTGACTCGACAGGCTCTA
--V--S--D--E--E--L--E--Q--M--L--D--S--G--Q--S--E--V--F--V--S-----I--L--K--D--T--Q--V--T--R--Q--A--L-

----------------------------------------------------------------------------------------------------
-N--E--I--S--A--R--H--S--E--I--Q--Q--L--E--R--S--I--R--E--L--H--D--I--F--T--F--L--A--T--E--V--E--M--
AATGAGATCTCGGCCCGGCACAGTGAGATCCAGCAGCTTGAACGCAGTATTCGTGAGCTGCACGACATATTCACTTTTCTGGCTACCGAAGTGGAGATGC
:::::::::::::::::::::::.::::::::::::::.::.::.:::::.:::::.:: ::.:: :: ::::::::::::::::: ::.::::::::::
AATGAGATCTCGGCCCGGCACAGCGAGATCCAGCAGCTCGAGCGTAGTATCCGTGAACTTCATGAGATCTTCACTTTTCTGGCTACGGAGGTGGAGATGC
-N--E--I--S--A--R--H--S--E--I--Q--Q--L--E--R--S--I--R--E--L--H--E--I--F--T--F--L--A--T--E--V--E--M--

-><-------------------------------------------------------------------------------------------------
Q--G--E--M--I--N--R--I--E--K--N--I--L--S--S--A--D--Y--V--E--R--G--Q--E--H--V--K--T--A--L--E--N--Q--K
AGGGGGAGATGATCAATCGGATTGAGAAGAACATCCTGAGCTCAGCGGACTACGTGGAACGTGGGCAGGAGCACGTCAAGACGGCCCTGGAGAACCAGAA
::::::::::::::::.::.::.:::::::::::.:::::::::::.:::::.:::::::::::::::::.::::::::::.::::::::::::::::::
AGGGGGAGATGATCAACCGAATCGAGAAGAACATTCTGAGCTCAGCAGACTATGTGGAACGTGGGCAGGAACACGTCAAGATGGCCCTGGAGAACCAGAA
Q--G--E--M--I--N--R--I--E--K--N--I--L--S--S--A--D--Y--V--E--R--G--Q--E--H--V--K--M--A--L--E--N--Q--K

------------><------------------------------------------------------------------------------->
--K--A--R--K--K--K--V--L--I--A--I--C--V--S--I--T--V--V--L--L--A--V--I--I--G--V--T--V--V--G--*-
GAAGGCGAGGAAGAAGAAAGTCTTGATTGCCATCTGTGTGTCCATCACCGTCGTCCTCCTAGCAGTCATCATTGGCGTCACAGTGGTTGGATAA
::::::.::::::                                                                                 
GAAGGCAAGGAAG---------------------------------------------------------------------------------
--K--A--R--K----------------------------------------------------------------------------------

Pig Consensus Sequence

>BGISUST0000890831
------------------------------GGAGATGACAGCTCTGACGATGAGGACAAGGAGAGGGTCGCGCTGGTGGTACACCCGGGCACGGCACGGC
TGGGCAGCCCAGACGATGAGTTCTTCCAGAAGGTCCGGACAATTCGGCAGACTATTGTCAAGCTGGAGAATAAGGTCCGAGAGTTGGAGAAGCAGCAGGT
CACCATCCTGGCCACGCCCCTTCCCGAGGAG---ATGAAGCAGGACCTGCAGAACCTGCGTGACGAGATCAAACAGCTGGGGAGGGACATCCGCGCAGAG
CTCAAG---ATAGAGCCCCAGAAGGAGGAAGCCGATGAGAATTATAACTCGGTCAACACAAGAATGAGAAAAACCCAGCATGGNGTCCTGTCCCAGCAAT
TCGTGGAGCTCATCAACAAGTGCAACTCCATGCAGTCCGAGTACCGGTAGAAGAACGTGGAGCGG------------------------AATGCTGGCAT
GGTGTCTGACGAGGAGCTGGAGCAGATGCTGGACAGCGGGCAGAGCGAGGTGTTTGTGTCC---ATACTGAAGGACACACAGGTGACTCGACAGGCTCTA
AATGAGATCTCGGCCCGGCACAGCGAGATCCAGCAGCTCGAGCGTAGTATCCGTGAACTTCATGAGATCTTCACTTTTCTGGCTACGGAGGTGGAGATGC
AGGGGGAGATGATCAACCGAATCGAGAAGAACATTCTGAGCTCAGCAGACTATGTGGAACGTGGGCAGGAACACGTCAAGATGGCCCTGGAGAACCAGAA
GAAGGCAAGGAAG---------------------------------------------------------------------------------


>BGISUSP0000890831
----------GDDSSDDEDKERVALVVHPGTARLGSPDDEFFQKVRTIRQTIVKLENKVRELEKQQVTILATPLPEE-MKQDLQNLRDEIKQLGRDIRAE
LK-IEPQKEEADENYNSVNTRMRKTQH-VLSQQFVELINKCNSMQSEYR*KNVER--------NAGMVSDEELEQMLDSGQSEVFVS-ILKDTQVTRQAL
NEISARHSEIQQLERSIRELHEIFTFLATEVEMQGEMINRIEKNILSSADYVERGQEHVKMALENQKKARK---------------------------