Sequences
EST Library Info
jca2Joint capsule
Clusters
Oligos
SNPs

Gene ID ENSG00000181826 (click for geneview)
Transcript ID ENST00000314117(link to ensembl)
Symbol Q8IUW5_HUMAN
Localtion Chromosome:4:37414988:37510563:-1 band: 4p14
Description Similar to expressed sequence AA536743.
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<--------------------------------------------------------------------------------------><-----------
-M--A--P--R--A--L--P--G--S--A--V--L--A--A--A--V--F--V--G--G--A--V--S--S--P--L--V--A--P--D--N--G--S--
ATGGCTCCGCGGGCACTCCCGGGGTCCGCCGTCCTAGCCGCTGCTGTCTTCGTGGGAGGCGCCGTGAGTTCGCCGCTGGTGGCTCCGGACAATGGGAGCA
:::::::.::::: ::::::::::::::::::::: ::::::::::::::::::::::::::::::::::::::.:: ::.::.:::   ::::: .:::
ATGGCTCTGCGGGGACTCCCGGGGTCCGCCGTCCTCGCCGCTGCTGTCTTCGTGGGAGGCGCCGTGAGTTCGCCACTCGTAGCCCCG---AATGGTGGCA
-M--A--L--R--G--L--P--G--S--A--V--L--A--A--A--V--F--V--G--G--A--V--S--S--P--L--V--A--P-----N--G--G--

----------------------------------------------------------------------------------------------------
S--R--T--L--H--S--R--T--E--T--T--P--S--P--S--N--D--T--G--N--G--H--P--E--Y--I--A--Y--A--L--V--P--V--F
GCCGCACATTGCACTCCAGAACAGAGACGACCCCGTCGCCCAGCAACGATACTGGGAATGGACACCCAGAATATATTGCATACGCGCTTGTCCCTGTGTT
::::::.:::.::.:::.:::: .::::::: :: ::.::::  :::.:.::::::::::::::::::::::::::.::.::.:::::.:::::.:::::
GCCGCATATTACATTCCGGAACCAAGACGACGCCCTCACCCACAAACAACACTGGGAATGGACACCCAGAATATATCGCGTATGCGCTCGTCCCCGTGTT
S--R--I--L--H--S--G--T--K--T--T--P--S--P--T--N--N--T--G--N--G--H--P--E--Y--I--A--Y--A--L--V--P--V--F

----------------------------------------------------------------------------------------------------
--F--I--M--G--L--F--G--V--L--I--C--H--L--L--K--K--K--G--Y--R--C--T--T--E--A--E--Q--D--I--E--E--E--K-
CTTTATCATGGGTCTCTTTGGCGTCCTCATTTGCCACCTGCTTAAGAAGAAAGGCTATCGTTGTACAACAGAAGCAGAGCAAGATATCGAAGAGGAAAAG
:::.::::::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::::::::: ::::::::..: ::::::::::::
CTTCATCATGGGTCTCTTTGGCGTCCTCATCTGCCACCTGCTTAAGAAGAAAGGCTATCGTTGTACAACAGAAGCCGAGCAAGACGTGGAAGAGGAAAAG
--F--I--M--G--L--F--G--V--L--I--C--H--L--L--K--K--K--G--Y--R--C--T--T--E--A--E--Q--D--V--E--E--E--K-

------------><----------------------------------------------------------------------><--------------
-V--E--K--I--E--L--N--D--S--V--N--E--N--S--D--T--V--G--Q--I--V--H--Y--I--M--K--N--E--A--N--A--D--V--
GTTGAAAAGATAGAATTGAATGACAGTGTGAATGAAAACAGTGACACTGTTGGGCAAATCGTCCACTACATCATGAAAAATGAAGCGAATGCTGATGTCT
::::::::::::    ::::.:::::.:::::::::::.::::::::.:::::.::.::.::::::::::::::::::::::::   :::::.:::::.:
GTTGAAAAGATA---ATGAACGACAGCGTGAATGAAAATAGTGACACCGTTGGACAGATTGTCCACTACATCATGAAAAATGAA---AATGCCGATGTTT
-V--E--K--I-----M--N--D--S--V--N--E--N--S--D--T--V--G--Q--I--V--H--Y--I--M--K--N--E-----N--A--D--V--

------------------------------------------><--------------------------------------------------------
L--K--A--M--V--A--D--N--S--L--Y--D--P--E--S--P--V--T--P--S--T--P--G--S--P--P--V--S--P--G--P--L--S--P
TAAAGGCGATGGTAGCAGATAACAGCCTGTATGATCCTGAAAGCCCCGTGACCCCCAGCACACCAGGGAGCCCGCCAGTGAGTCCTGGGCCTTTGTCACC
:.:::::.:::::.:::::::::::::::::::::::::::   ::.:::::::::::::: :: ::::::::::: :::::.::.:::::.::::::::
TGAAGGCAATGGTGGCAGATAACAGCCTGTATGATCCTGAA---CCTGTGACCCCCAGCACTCCTGGGAGCCCGCCCGTGAGCCCCGGGCCCTTGTCACC
L--K--A--M--V--A--D--N--S--L--Y--D--P--E-----P--V--T--P--S--T--P--G--S--P--P--V--S--P--G--P--L--S--P

----------------------------------------------------------------------------------------------------
--G--G--T--P--G--K--H--V--C--G--H--H--L--H--T--V--G--G--V--V--E--R--D--V--C--H--R--C--R--H--K--R--W-
AGGGGGGACGCCAGGGAAGCACGTCTGTGGCCATCATCTGCATACGGTGGGCGGTGTTGTCGAGAGGGATGTGTGTCATCGGTGTAGGCACAAGCGGTGG
.::.:: :: :::::.::::::.::::.:::::.::::::::.::.::::::::::.::::::: ::::.:::::::::::.::::::::.:::::::::
GGGAGGCACCCCAGGAAAGCACATCTGCGGCCACCATCTGCACACAGTGGGCGGTGCTGTCGAGCGGGACGTGTGTCATCGATGTAGGCATAAGCGGTGG
--G--G--T--P--G--K--H--I--C--G--H--H--L--H--T--V--G--G--A--V--E--R--D--V--C--H--R--C--R--H--K--R--W-

-------------------------------------------------------------------------------><-------------------
-H--F--I--K--P--T--N--K--S--R--E--S--R--P--R--R--Q--G--E--V--T--V--L--S--V--G--R--F--R--V--T--K--V--
CACTTTATAAAGCCCACTAACAAGTCCAGAGAGAGCAGACCACGGCGCCAAGGCGAGGTCACGGTCCTTTCTGTTGGCAGATTTAGAGTTACAAAAGTGG
:::::.:: :..::..:.::::::::::.::::.:: : ::. :::::::::: ::::::                                        
CACTTCATCAGACCTGCCAACAAGTCCAAAGAGGGCCGCCCGAGGCGCCAAGGGGAGGTC----------------------------------------
-H--F--I--R--P--A--N--K--S--K--E--G--R--P--R--R--Q--G--E--V-----------------------------------------

----------------------------------------------------------------------------------------------------
E--H--K--S--N--Q--K--E--R--R--S--L--M--S--V--S--G--A--E--T--V--N--G--E--V--P--A--T--P--V--K--R--E--R
AGCACAAGTCAAACCAGAAGGAACGGAGAAGCCTGATGTCTGTTAGTGGGGCTGAAACCGTCAATGGGGAGGTGCCGGCAACACCTGTGAAGAGAGAACG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------->
--S--G--T--E--*-
CAGTGGCACAGAGTAG
                
----------------
----------------

Pig Consensus Sequence

>BGISUST0000895481
ATGGCTCTGCGGGGACTCCCGGGGTCCGCCGTCCTCGCCGCTGCTGTCTTCGTGGGAGGCGCCGTGAGTTCGCCACTCGTAGCCCCG---AATGGTGGCA
GCCGCATATTACATTCCGGAACCAAGACGACGCCCTCACCCACAAACAACACTGGGAATGGACACCCAGAATATATCGCGTATGCGCTCGTCCCCGTGTT
CTTCATCATGGGTCTCTTTGGCGTCCTCATCTGCCACCTGCTTAAGAAGAAAGGCTATCGTTGTACAACAGAAGCCGAGCAAGACGTGGAAGAGGAAAAG
GTTGAAAAGATA---ATGAACGACAGCGTGAATGAAAATAGTGACACCGTTGGACAGATTGTCCACTACATCATGAAAAATGAA---AATGCCGATGTTT
TGAAGGCAATGGTGGCAGATAACAGCCTGTATGATCCTGAA---CCTGTGACCCCCAGCACTCCTGGGAGCCCGCCCGTGAGCCCCGGGCCCTTGTCACC
GGGAGGCACCCCAGGAAAGCACATCTGCGGCCACCATCTGCACACAGTGGGCGGTGCTGTCGAGCGGGACGTGTGTCATCGATGTAGGCATAAGCGGTGG
CACTTCATCAGACCTGCCAACAAGTCCAAAGAGGGCCGCCCGAGGCGCCAAGGGGAGGTC----------------------------------------
----------------------------------------------------------------------------------------------------
----------------


>BGISUSP0000895481
MALRGLPGSAVLAAAVFVGGAVSSPLVAP-NGGSRILHSGTKTTPSPTNNTGNGHPEYIAYALVPVFFIMGLFGVLICHLLKKKGYRCTTEAEQDVEEEK
VEKI-MNDSVNENSDTVGQIVHYIMKNE-NADVLKAMVADNSLYDPE-PVTPSTPGSPPVSPGPLSPGGTPGKHICGHHLHTVGGAVERDVCHRCRHKRW
HFIRPANKSKEGRPRRQGEV----------------------------------------------------