Sequences
EST Library Info
hyp2Hypothalamus
plac2Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000079805 (click for geneview)
Transcript ID ENST00000314646(link to ensembl)
Symbol Q8N1K8_HUMAN
Localtion Chromosome:19:10767095:10803579:1 band: 19p13.2
Description Hypothetical protein FLJ40556.
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--A--F--E--A--I--V--K--K--Q--I--V--K--L--K--E--P--S--L--K--C--V--D--L--V--V--S--E--L--A--T--V--I--
ATGGCCTTTGAAGCCATTGTGAAAAAACAGATTGTAAAACTCAAAGAGCCGAGTTTGAAGTGTGTTGATCTCGTGGTCTCAGAGCTGGCCACGGTCATAA
::::::::::::::::::::::::::::::::::::::::::::::::::.::::::::::::::::::::::::::.:::::.:::::::::::::: :
ATGGCCTTTGAAGCCATTGTGAAAAAACAGATTGTAAAACTCAAAGAGCCAAGTTTGAAGTGTGTTGATCTCGTGGTTTCAGAACTGGCCACGGTCATTA
-M--A--F--E--A--I--V--K--K--Q--I--V--K--L--K--E--P--S--L--K--C--V--D--L--V--V--S--E--L--A--T--V--I--

----------------><----------------------------------------------------------------------------------
K--K--C--A--E--K--L--S--S--Y--P--R--L--R--E--E--T--E--R--I--V--T--T--Y--I--R--E--R--E--G--R--T--K--D
AAAAGTGTGCCGAGAAGCTCAGTTCCTACCCCCGGTTGCGAGAGGAGACAGAGCGAATCGTCACCACTTACATCCGGGAACGGGAGGGGAGAACGAAGGA
::::::::::::::::::::::.::::::::::::.:::::::::::::.::.::::::::::::::::::::::::::::::::::::::::: :::::
AAAAGTGTGCCGAGAAGCTCAGCTCCTACCCCCGGCTGCGAGAGGAGACGGAACGAATCGTCACCACTTACATCCGGGAACGGGAGGGGAGAACCAAGGA
K--K--C--A--E--K--L--S--S--Y--P--R--L--R--E--E--T--E--R--I--V--T--T--Y--I--R--E--R--E--G--R--T--K--D

---><---------------------------------------------------------------------><------------------------
--Q--I--L--L--L--I--D--I--E--Q--S--Y--I--N--T--N--H--E--D--F--I--G--F--A--N--A--Q--Q--R--S--T--Q--L-
CCAGATTCTTCTGCTGATCGACATTGAGCAGTCCTACATCAACACGAACCATGAGGACTTCATCGGGTTTGCCAATGCCCAGCAGAGGAGCACGCAGCTG
:::::::::::: :::::::::::.::::::::::::::::::::::::::.:::::::::::.::.::::::   :::::::::::.:::::.::::::
CCAGATTCTTCTTCTGATCGACATCGAGCAGTCCTACATCAACACGAACCACGAGGACTTCATTGGATTTGCC---GCCCAGCAGAGAAGCACACAGCTG
--Q--I--L--L--L--I--D--I--E--Q--S--Y--I--N--T--N--H--E--D--F--I--G--F--A-----A--Q--Q--R--S--T--Q--L-

--------------------------><----------><------------------------------------------------------------
-N--K--K--R--A--I--P--N--Q--A--A--L--C--V--I--R--R--G--W--L--T--I--N--N--I--S--L--M--K--G--G--S--K--
AACAAGAAGAGAGCCATCCCCAATCAGGCCGCCCTGTGCGTGATCCGCAGGGGCTGGCTGACCATCAACAACATCAGCCTGATGAAAGGCGGCTCCAAGG
:::::::::::::::::::::::.:::            ::::::::: :::::::::::::::::::::::::::::::::::::.:::::::::::::
AACAAGAAGAGAGCCATCCCCAACCAG------------GTGATCCGCCGGGGCTGGCTGACCATCAACAACATCAGCCTGATGAAGGGCGGCTCCAAGG
-N--K--K--R--A--I--P--N--Q--------------V--I--R--R--G--W--L--T--I--N--N--I--S--L--M--K--G--G--S--K--

----------------------------------------------------><----------------------------------------------
E--Y--W--F--V--L--T--A--E--S--L--S--W--Y--K--D--E--E--E--K--E--K--K--Y--M--L--P--L--D--N--L--K--I--R
AGTACTGGTTTGTGCTGACTGCCGAGTCACTGTCCTGGTACAAGGATGAGGAGGAGAAAGAGAAGAAGTACATGCTGCCTCTGGACAACCTCAAGATCCG
:.::::::::::::::::: ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.:::::
AATACTGGTTTGTGCTGACAGCCGAGTCACTGTCCTGGTACAAGGATGAGGAGGAGAAAGAGAAGAAGTACATGCTGCCTCTGGACAACCTCAAAATCCG
E--Y--W--F--V--L--T--A--E--S--L--S--W--Y--K--D--E--E--E--K--E--K--K--Y--M--L--P--L--D--N--L--K--I--R

-----------------------------------------------------------------><---------------------------------
--D--V--E--K--G--F--M--S-----N--K--H--V--F--A--I--F--N--T--E--Q--R--N--V--Y--K--D--L--R--Q--I--E--L-
TGATGTGGAGAAGGGCTTCATGTCC---AACAAGCACGTCTTCGCCATCTTCAACACGGAGCAGAGAAACGTCTACAAGGACCTGCGGCAGATCGAGCTG
:::::::::.:::::::::::::::   ::::::::.::::::::::::::::::::.::::::   :::::::::::::::::::::::::::::::::
TGATGTGGAAAAGGGCTTCATGTCCA--AACAAGCATGTCTTCGCCATCTTCAACACAGAGCAG---AACGTCTACAAGGACCTGCGGCAGATCGAGCTG
--D--V--E--K--G--F--M--S--\--N--K--H--V--F--A--I--F--N--T--E--Q-----N--V--Y--K--D--L--R--Q--I--E--L-

-----------------------------------------------------------------------------><---------------------
-A--C--D--S--Q--E--D--V--D--S--W--K--A--S--F--L--R--A--G--V--Y--P--E--K--D--Q--A--E--N--E--D--G--A--
GCCTGTGACTCCCAGGAAGACGTGGACAGCTGGAAGGCCTCGTTCCTCCGAGCTGGCGTCTACCCCGAGAAGGACCAGGCAGAAAACGAGGATGGGGCCC
:::::::::::::::::.:::::::::::::::::::::::.:::::::::::.:: ::::::::.:::::::::::::::::.::.::::::::.::::
GCCTGTGACTCCCAGGAGGACGTGGACAGCTGGAAGGCCTCATTCCTCCGAGCCGGGGTCTACCCTGAGAAGGACCAGGCAGAGAATGAGGATGGAGCCC
-A--C--D--S--Q--E--D--V--D--S--W--K--A--S--F--L--R--A--G--V--Y--P--E--K--D--Q--A--E--N--E--D--G--A--

----------------------------------------------------------------------------------------------------
Q--E--N--T--F--S--M--D--P--Q--L--E--R--Q--V--E--T--I--R--N--L--V--D--S--Y--V--A--I--I--N--K--S--I--R
AGGAGAACACCTTCTCCATGGACCCCCAACTGGAGCGGCAGGTGGAGACCATTCGCAACCTGGTGGACTCATACGTGGCCATCATCAACAAGTCCATCCG
::::::::::::::::::::::::: ::.::.::::: ::::::::::::::::: ::::::::::::::::::::::::::::::::::::::::::::
AGGAGAACACCTTCTCCATGGACCCGCAGCTAGAGCGCCAGGTGGAGACCATTCGAAACCTGGTGGACTCATACGTGGCCATCATCAACAAGTCCATCCG
Q--E--N--T--F--S--M--D--P--Q--L--E--R--Q--V--E--T--I--R--N--L--V--D--S--Y--V--A--I--I--N--K--S--I--R

------------------------------------------><--------------------------------------------------------
--D--L--M--P--K--T--I--M--H--L--M--I--N--N--T--K--A--F--I--H--H--E--L--L--A--Y--L--Y--S--S--A--D--Q-
CGACCTCATGCCAAAGACCATCATGCACCTCATGATCAACAATACGAAGGCCTTCATCCACCACGAGCTGCTGGCCTACCTATACTCCTCGGCAGACCAG
.::::::::::::::::::::::::::::::::::::::.   ::::::::::::::::::::.:::::::::::::::::.::::: ::.:: ::::::
TGACCTCATGCCAAAGACCATCATGCACCTCATGATCAAT---ACGAAGGCCTTCATCCACCATGAGCTGCTGGCCTACCTGTACTCGTCAGCCGACCAG
--D--L--M--P--K--T--I--M--H--L--M--I--N-----T--K--A--F--I--H--H--E--L--L--A--Y--L--Y--S--S--A--D--Q-

----------------------------------------------------------------------------------------------------
-S--S--L--M--E--E--S--A--D--Q--A--Q--R--R--D--D--M--L--R--M--Y--H--A--L--K--E--A--L--N--I--I--G--D--
AGCAGCCTCATGGAGGAGTCGGCTGACCAGGCACAGCGGCGGGACGACATGCTGCGCATGTACCATGCCCTCAAGGAGGCGCTCAACATCATCGGTGACA
::::::::::::::::::::.::::::::::: ::::::::::::::::::::::::::::::::::: :::::::::::.:::::::::::.:: ::::
AGCAGCCTCATGGAGGAGTCAGCTGACCAGGCCCAGCGGCGGGACGACATGCTGCGCATGTACCATGCGCTCAAGGAGGCACTCAACATCATTGGGGACA
-S--S--L--M--E--E--S--A--D--Q--A--Q--R--R--D--D--M--L--R--M--Y--H--A--L--K--E--A--L--N--I--I--G--D--

---------------------------------------------------------------------------><-----------------------
I--S--T--S--T--V--S--T--P--V--P--P--P--V--D--D--T--W--L--Q--S--A--S--S--H--S--P--T--P--Q--R--R--P--V
TCAGCACCAGCACTGTGTCCACGCCTGTACCCCCGCCTGTCGATGACACCTGGCTCCAGAGCGCCAGCAGCCACAGCCCCACTCCACAGCGCCGACCGGT
:::::::::::::.::::::::::: ::.::::::::.::.:::::::::::::::::::::.:::::::::::   ::::::::.::.:::::.:: ::
TCAGCACCAGCACCGTGTCCACGCCGGTGCCCCCGCCCGTTGATGACACCTGGCTCCAGAGCACCAGCAGCCAC---CCCACTCCGCAACGCCGGCCTGT
I--S--T--S--T--V--S--T--P--V--P--P--P--V--D--D--T--W--L--Q--S--T--S--S--H-----P--T--P--Q--R--R--P--V

----------------------------------------------------------------------------------------------------
--S--S--I--H--P--P--G--R--P--P--A--V--R--G--P--T--P--G--P--P--L--I--P--V--P--V--G--A--A--A--S--F--S-
GTCCAGCATACACCCCCCTGGCCGGCCCCCAGCAGTGAGGGGCCCCACTCCAGGGCCCCCCCTGATTCCTGTTCCCGTGGGGGCAGCAGCCTCCTTCTCG
:::::::.:.:::::::: :::::::::::::::::::::::::::::.::.:::::::::::::::::::: :: :::::.::::::::::::::::: 
GTCCAGCGTGCACCCCCCAGGCCGGCCCCCAGCAGTGAGGGGCCCCACCCCGGGGCCCCCCCTGATTCCTGTGCCGGTGGGAGCAGCAGCCTCCTTCTCC
--S--S--V--H--P--P--G--R--P--P--A--V--R--G--P--T--P--G--P--P--L--I--P--V--P--V--G--A--A--A--S--F--S-

----------------------------------------------------------------------------------------------------
-A--P--P--I--P--S--R--P--G--P--Q-----S--V--F--A--N--S--D--L--F--P--A--P--P--Q--I--P--S--R--P--V--R--
GCGCCCCCAATCCCATCCCGGCCTGGACCCCAG---AGCGTGTTTGCCAACAGTGACCTCTTCCCAGCCCCGCCTCAGATCCCATCTCGGCCAGTTCGGA
:::::::: :::::::::::::::::::::::    .:::::::::::::::.:::::.::::.:.:::::::::::::::::::::::.::::.:::::
GCGCCCCCCATCCCATCCCGGCCTGGACCCCATCCTGGCGTGTTTGCCAACAATGACCCCTTCTCGGCCCCGCCTCAGATCCCATCTCGACCAGCTCGGA
-A--P--P--I--P--S--R--P--G--P--H--P--G--V--F--A--N--N--D--P--F--S--A--P--P--Q--I--P--S--R--P--A--R--

------------------------------><--------------------------------------------------------------------
I--P--P--G--I--P--P--G--V--P--S--R--R--P--P--A--A--P--S--R--P--T--I--I--R--P--A--E--P--S--L--L--D--*
TCCCCCCAGGGATTCCCCCAGGAGTGCCCAGCAGAAGACCCCCTGCTGCGCCCAGCCGGCCCACCATTATCCGCCCAGCCGAGCCATCCCTGCTCGACTA
:.:: :: :: :: ::::: ::::: :::   ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
TTCCACCCGGCATACCCCCCGGAGTCCCC---AGAAGACCCCCTGCTGCGCCCAGCCGGCCCACCATTATCCGCCCAGCCGAGCCATCCCTGCTCGACTA
I--P--P--G--I--P--P--G--V--P-----R--R--P--P--A--A--P--S--R--P--T--I--I--R--P--A--E--P--S--L--L--D--*

>
-
G
:
G
-

Pig Consensus Sequence

>BGISUST0000887359
ATGGCCTTTGAAGCCATTGTGAAAAAACAGATTGTAAAACTCAAAGAGCCAAGTTTGAAGTGTGTTGATCTCGTGGTTTCAGAACTGGCCACGGTCATTA
AAAAGTGTGCCGAGAAGCTCAGCTCCTACCCCCGGCTGCGAGAGGAGACGGAACGAATCGTCACCACTTACATCCGGGAACGGGAGGGGAGAACCAAGGA
CCAGATTCTTCTTCTGATCGACATCGAGCAGTCCTACATCAACACGAACCACGAGGACTTCATTGGATTTGCC---GCCCAGCAGAGAAGCACACAGCTG
AACAAGAAGAGAGCCATCCCCAACCAG------------GTGATCCGCCGGGGCTGGCTGACCATCAACAACATCAGCCTGATGAAGGGCGGCTCCAAGG
AATACTGGTTTGTGCTGACAGCCGAGTCACTGTCCTGGTACAAGGATGAGGAGGAGAAAGAGAAGAAGTACATGCTGCCTCTGGACAACCTCAAAATCCG
TGATGTGGAAAAGGGCTTCATGTCcaACAAGCATGTCTTCGCCATCTTCAACACAGAGCAG---AACGTCTACAAGGACCTGCGGCAGATCGAGCTGGCC
TGTGACTCCCAGGAGGACGTGGACAGCTGGAAGGCCTCATTCCTCCGAGCCGGGGTCTACCCTGAGAAGGACCAGGCAGAGAATGAGGATGGAGCCCAGG
AGAACACCTTCTCCATGGACCCGCAGCTAGAGCGCCAGGTGGAGACCATTCGAAACCTGGTGGACTCATACGTGGCCATCATCAACAAGTCCATCCGTGA
CCTCATGCCAAAGACCATCATGCACCTCATGATCAAT---ACGAAGGCCTTCATCCACCATGAGCTGCTGGCCTACCTGTACTCGTCAGCCGACCAGAGC
AGCCTCATGGAGGAGTCAGCTGACCAGGCCCAGCGGCGGGACGACATGCTGCGCATGTACCATGCGCTCAAGGAGGCACTCAACATCATTGGGGACATCA
GCACCAGCACCGTGTCCACGCCGGTGCCCCCGCCCGTTGATGACACCTGGCTCCAGAGCACCAGCAGCCAC---CCCACTCCGCAACGCCGGCCTGTGTC
CAGCGTGCACCCCCCAGGCCGGCCCCCAGCAGTGAGGGGCCCCACCCCGGGGCCCCCCCTGATTCCTGTGCCGGTGGGAGCAGCAGCCTCCTTCTCCGCG
CCCCCCATCCCATCCCGGCCTGGACCCCATCCTGGCGTGTTTGCCAACAATGACCCCTTCTCGGCCCCGCCTCAGATCCCATCTCGACCAGCTCGGATTC
CACCCGGCATACCCCCCGGAGTC---AGAAGACCCCCTGCTGCGCCCAGCCGGCCCACCATTATCCGCCCAGCCGAGCCATCCCTGCTCGACTAG


>BGISUSP0000887359
MAFEAIVKKQIVKLKEPSLKCVDLVVSELATVIKKCAEKLSSYPRLREETERIVTTYIREREGRTKDQILLLIDIEQSYINTNHEDFIGFA-AQQRSTQL
NKKRAIPNQ----VIRRGWLTINNISLMKGGSKEYWFVLTAESLSWYKDEEEKEKKYMLPLDNLKIRDVEKGFMSNKHVFAIFNTEQ-NVYKDLRQIELA
CDSQEDVDSWKASFLRAGVYPEKDQAENEDGAQENTFSMDPQLERQVETIRNLVDSYVAIINKSIRDLMPKTIMHLMIN-TKAFIHHELLAYLYSSADQS
SLMEESADQAQRRDDMLRMYHALKEALNIIGDISTSTVSTPVPPPVDDTWLQSTSSH-PTPQRRPVSSVHPPGRPPAVRGPTPGPPLIPVPVGAAASFSA
PPIPSRPGPHPGVFANNDPFSAPPQIPSRPARIPPGIPPGV-RRPPAAPSRPTIIRPAEPSLLD*