Sequences
EST Library Info
eep2Foetus 50 days, epidermis
Clusters
Oligos
SNPs

Gene ID ENSG00000178921 (click for geneview)
Transcript ID ENST00000314666(link to ensembl)
Symbol PFAS
Localtion Chromosome:17:8093362:8114528:1 band: 17p13.1
Description Phosphoribosylformylglycinamidine synthase (EC 6.3.5.3) (FGAM synthase) (FGAMS) (Formylglycinamide ribotide amidotransferase) (FGARAT) (Formylglycinamide ribotide synthetase). [Source:Uniprot/SWISSPROT;Acc:O15067]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--S--P--V--L--H--F--Y--V--R--P--S--G--H--E--G--A--A--P--G--H--T--R--R--K--L--Q--G--K--L--P--E--L--
ATGTCCCCAGTCCTTCACTTCTATGTTCGTCCCTCTGGCCATGAGGGGGCAGCCCCTGGACACACTCGGAGGAAACTGCAAGGGAAACTGCCAGAGCTGC
::::::.:::::::::::::.: ::: ::::::::::::::.::::::::::::.::: :.:::: :..:::::.::::.::::.::::::::: :::::
ATGTCCTCAGTCCTTCACTTTTTTGTGCGTCCCTCTGGCCACGAGGGGGCAGCCTCTGCATACACACAAAGGAAGCTGCGAGGGGAACTGCCAGCGCTGC
-M--S--S--V--L--H--F--F--V--R--P--S--G--H--E--G--A--A--S--A--Y--T--Q--R--K--L--R--G--E--L--P--A--L--

-----------------------------------------><---------------------------------------------------------
Q--G--V--E--T--E--L--C--Y--N--V--N--W--T--A--E--A--L--P--S--A--E--E--T--K--K--L--M--W--L--F--G--C--P
AGGGCGTCGAGACTGAACTGTGCTACAACGTGAACTGGACAGCTGAGGCCCTCCCCAGTGCTGAGGAGACAAAGAAGCTGATGTGGCTGTTTGGTTGCCC
::::..::.:::::::..:::::::::::::::::::::::   ::: ::.:::: ::.::.:::::::..:::::.::::. :::::::::::.:::::
AGGGTATCAAGACTGAGTTGTGCTACAACGTGAACTGGACA---GAGTCCTTCCCAAGCGCCGAGGAGATGAAGAAACTGACCTGGCTGTTTGGCTGCCC
Q--G--I--K--T--E--L--C--Y--N--V--N--W--T-----E--S--F--P--S--A--E--E--M--K--K--L--T--W--L--F--G--C--P

-----------------------------------------------------------------------------><---------------------
--L--L--L--D--D--V--A--R--E--S--W--L--L--P--G--S--N--D--L--L--L--E--V--G--P--R--L--N--F--S--T--P--T-
CTTACTGCTGGATGATGTTGCTCGGGAGTCCTGGCTCCTTCCTGGCTCCAATGACCTGCTGCTGGAGGTCGGGCCCAGGCTGAACTTCTCCACCCCAACA
:::..:.:::::.::::::::::.::::::::::::::::::.:::::::::::::::::::::::::::::::::                        
CTTGTTACTGGACGATGTTGCTCAGGAGTCCTGGCTCCTTCCCGGCTCCAATGACCTGCTGCTGGAGGTCGGGCCC------------------------
--L--L--L--D--D--V--A--Q--E--S--W--L--L--P--G--S--N--D--L--L--L--E--V--G--P-------------------------

-----------------------------------------------------------------------------------><---------------
-S--T--N--I--V--S--V--C--R--A--T--G--L--G--P--V--D--R--V--E--T--T--R--R--Y--R--L--S--F--A--H--P--P--
TCCACCAACATCGTGTCAGTGTGCCGCGCCACTGGGCTGGGGCCTGTGGATCGTGTGGAGACCACCCGGCGCTACCGGCTCTCGTTTGCCCACCCCCCGT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
S--A--E--V--E--A--I--A--L--A--T--L--H--D--R--M--T--E--Q--H--F--P--H--P--I--Q--S--F--S--P--E--S--M--P
CAGCTGAGGTGGAAGCCATTGCTCTGGCTACCCTGCACGACCGGATGACAGAGCAGCACTTCCCCCATCCCATCCAGAGTTTCTCCCCTGAGAGCATGCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------------------------------------------------------><-------------------------
--E--P--L--N--G--P--I--N--I--L--G--E--G--R--L--A--L--E--K--A--N--Q--E--L--G--L--A--L--D--S--W--D--L-
GGAACCCCTCAATGGCCCTATCAATATACTGGGTGAGGGCCGGCTTGCGCTGGAGAAGGCCAACCAGGAGCTTGGTCTGGCTTTAGACTCTTGGGACCTA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------------------------------------------------------------><-------------------
-D--F--Y--T--K--R--F--Q--E--L--Q--R--N--P--S--T--V--E--A--F--D--L--A--Q--S--N--S--E--H--S--R--H--W--
GACTTCTACACCAAGCGCTTCCAGGAGCTACAGCGGAACCCGAGCACTGTGGAGGCCTTTGACTTGGCGCAGTCCAATAGCGAGCACAGCCGACACTGGT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
F--F--K--G--Q--L--H--V--D--G--Q--K--L--V--H--S--L--F--E--S--I--M--S--T--Q--E--S--S--N--P--N--N--V--L
TCTTCAAGGGCCAGCTCCACGTGGATGGGCAGAAGCTGGTGCACTCACTGTTTGAGTCCATCATGAGCACCCAGGAATCCTCGAACCCCAACAACGTCCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------><------------------------------------------------------------------------------
--K--F--C--D--N--S--S--A--I--Q--G--K--E--V--R--F--L--R--P--E--D--P--T--R--P--S--R--F--Q--Q--Q--Q--G-
CAAATTCTGTGATAACAGCAGTGCAATCCAGGGAAAGGAAGTCCGATTCCTACGGCCTGAGGACCCCACACGGCCAAGCCGCTTCCAGCAACAGCAAGGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------------------------------------------><-----------------------------------------------------
-L--R--H--V--V--F--T--A--E--T--H--N--F--P--T--G--V--C--P--F--S--G--A--T--T--G--T--G--G--R--I--R--D--
CTGAGACATGTTGTCTTCACAGCAGAGACTCACAACTTTCCCACAGGAGTATGCCCCTTTAGTGGTGCAACCACTGGCACAGGGGGCCGGATTCGAGATG
                                                : :  ::::::.::.:::::::::::::::::::::::::::::.:: ::.:
------------------------------------------------GAAGCCCCCTTCAGCGGTGCAACCACTGGCACAGGGGGCCGGATCCGTGACG
-------------------------------------------------E--A--P--F--S--G--A--T--T--G--T--G--G--R--I--R--D--

--------------------------------------------------------------------------><------------------------
V--Q--C--T--G--R--G--A--H--V--V--A--G--T--A--G--Y--C--F--G--N--L--H--I--P--G--Y--N--L--P--W--E--D--P
TCCAGTGCACAGGCCGCGGGGCCCACGTGGTGGCTGGCACTGCCGGCTATTGCTTTGGAAATCTGCATATTCCAGGTTACAATCTGCCCTGGGAGGATCC
:::::::.:::::::::::::: ::.:::::::::::::::::.:::::::::::::::::.:::::..:.:::                          
TCCAGTGTACAGGCCGCGGGGCGCATGTGGTGGCTGGCACTGCTGGCTATTGCTTTGGAAACCTGCACGTCCCA--------------------------
V--Q--C--T--G--R--G--A--H--V--V--A--G--T--A--G--Y--C--F--G--N--L--H--V--P---------------------------

----------------------------------------------------------------------------------------------------
--S--F--Q--Y--P--G--N--F--A--R--P--L--E--V--A--I--E--A--S--N--G--A--S--D--Y--G--N--K--F--G--E--P--V-
AAGCTTCCAGTATCCTGGGAATTTTGCCCGGCCCCTGGAGGTTGCCATTGAAGCCAGTAATGGAGCTTCTGACTATGGCAACAAGTTTGGGGAACCAGTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------><--------------------------------------------------------------------------------------------
-L--A--G--F--A--R--S--L--G--L--Q--L--P--D--G--Q--R--R--E--W--I--K--P--I--M--F--S--G--G--I--G--S--M--
CTGGCTGGCTTCGCCCGCTCCTTGGGCCTCCAGCTCCCAGACGGCCAGCGGCGTGAGTGGATCAAGCCCATCATGTTTAGTGGGGGCATTGGGTCCATGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----------------------------------><---------------------------------------------------------------
E--A--D--H--I--S--K--E--A--P--E--P--G--M--E--V--V--K--V--G--G--P--V--Y--R--I--G--V--G--G--G--A--A--S
AAGCTGACCACATAAGCAAGGAGGCCCCAGAGCCAGGCATGGAAGTTGTAAAGGTTGGAGGTCCCGTCTACAGGATTGGAGTTGGAGGTGGAGCTGCTTC
                                      ::::: :::::.::::: ::.:::::.::::::::::::::::::::.::.::.::.::::.
--------------------------------------ATGGATGTTGTGAAGGTGGGGGGTCCTGTCTACAGGATTGGAGTTGGGGGCGGGGCCGCTTT
---------------------------------------M--D--V--V--K--V--G--G--P--V--Y--R--I--G--V--G--G--G--A--A--L

---------><-----------------------------------------------------------------------------------------
--S--V--Q--V--Q--G--D--N--T--S--D--L--D--F--G--A--V--Q--R--G--D--P--E--M--E--Q--K--M--N--R--V--I--R-
ATCTGTGCAGGTGCAGGGAGATAACACCAGTGACCTGGACTTTGGGGCTGTGCAGCGAGGAGACCCGGAGATGGAACAGAAGATGAACCGTGTGATCAGG
::::::::::::.::::::::.:::.::::..::::::::::::::::::::::::::::.:::::.:::::::::::::::::::::::.:::::: :.
ATCTGTGCAGGTACAGGGAGACAACGCCAGCAACCTGGACTTTGGGGCTGTGCAGCGAGGGGACCCAGAGATGGAACAGAAGATGAACCGCGTGATCCGA
--S--V--Q--V--Q--G--D--N--A--S--N--L--D--F--G--A--V--Q--R--G--D--P--E--M--E--Q--K--M--N--R--V--I--R-

------------------------------------------------------------------><--------------------------------
-A--C--V--E--A--P--K--G--N--P--I--C--S--L--H--D--Q--G--A--G--G--N--G--N--V--L--K--E--L--S--D--P--A--
GCTTGTGTGGAGGCCCCCAAGGGAAACCCCATCTGCAGCCTTCATGATCAGGGCGCTGGTGGCAATGGCAATGTCCTAAAAGAGCTGAGTGACCCAGCTG
:::::::::::::::::::.:::::::::::::::::::::.:::::.::::::::.:::::::::                                  
GCTTGTGTGGAGGCCCCCAGGGGAAACCCCATCTGCAGCCTCCATGACCAGGGCGCCGGTGGCAAT----------------------------------
-A--C--V--E--A--P--R--G--N--P--I--C--S--L--H--D--Q--G--A--G--G--N-----------------------------------

----------------------------><----------------------------------------------------------------------
G--A--I--I--Y--T--S--R--F--Q--L--G--D--P--T--L--N--A--L--E--I--W--G--A--E--Y--Q--E--S--N--A--L--L--L
GAGCCATCATTTACACCAGCCGCTTCCAGCTTGGGGACCCAACCCTGAATGCCCTGGAAATCTGGGGGGCTGAGTACCAGGAATCAAATGCTCTTCTGCT
                                                                          ::::::::.:::::::: ::::::::
--------------------------------------------------------------------------TACCAGGAGTCAAATGCGCTTCTGCT
---------------------------------------------------------------------------Y--Q--E--S--N--A--L--L--L

------------------------------------------------------------------------------------------><--------
--R--S--P--N--R--D--F--L--T--H--V--S--A--R--E--R--C--P--A--C--F--V--G--T--I--T--G--D--R--R--I--V--L-
GAGGTCCCCCAACCGGGACTTCCTGACTCATGTCAGTGCCCGTGAACGTTGCCCGGCTTGCTTCGTGGGCACCATCACTGGAGACCGGAGAATAGTGCTG
::::.:::::.:::::::::::::::. :.::::::.::::: :::::. :::::::::::::.::::::::::::::.:::::. ::::::::::::::
GAGGCCCCCCGACCGGGACTTCCTGATGCGTGTCAGCGCCCGGGAACGCAGCCCGGCTTGCTTTGTGGGCACCATCACCGGAGATGGGAGAATAGTGCTG
--R--P--P--D--R--D--F--L--M--R--V--S--A--R--E--R--S--P--A--C--F--V--G--T--I--T--G--D--G--R--I--V--L-

----------------------------------------------------------------------------------------------------
-V--D--D--R--E--C--P--V--R--R--N--G--Q--G--D--A--P--P--T--P--L--P--T--P--V--D--L--E--L--E--W--V--L--
GTGGACGATCGGGAGTGTCCTGTCAGAAGAAATGGCCAGGGGGATGCCCCCCCGACACCCCTGCCAACCCCTGTGGACCTGGAGCTCGAATGGGTGCTGG
:::::.::.:.:::: ::::::: .:::::.:::::::::::::::::::::::                                              
GTGGATGACCAGGAGGGTCCTGTGGGAAGAGATGGCCAGGGGGATGCCCCCCCG----------------------------------------------
-V--D--D--Q--E--G--P--V--G--R--D--G--Q--G--D--A--P--P-----------------------------------------------

----------------><----------------------------------------------------------------------------------
G--K--M--P--R--K--E--F--F--L--Q--R--K--P--P--M--L--Q--P--L--A--L--P--P--G--L--S--V--H--Q--A--L--E--R
GCAAGATGCCTCGGAAGGAGTTCTTCCTGCAGAGGAAGCCCCCCATGCTGCAGCCTCTGGCCTTGCCCCCAGGGCTGAGCGTGCACCAGGCTCTGGAGAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------------------------------------------><--------------------------------------------------
--V--L--R--L--P--A--V--A--S--K--R--Y--L--T--N--K--V--D--R--S--V--G--G--L--V--A--Q--Q--Q--C--V--G--P-
GGTTCTGAGGCTGCCCGCCGTGGCCAGCAAGCGCTACCTCACCAATAAGGTGGACCGCTCTGTGGGAGGCCTGGTGGCCCAGCAGCAGTGCGTGGGGCCC
                                                 :::::::::::::::.: :::.::::::: :::::::::::.:::::.:::
-------------------------------------------------GTGGACCGCTCTGTGAGCGGCTTGGTGGCACAGCAGCAGTGTGTGGGACCC
--------------------------------------------------V--D--R--S--V--S--G--L--V--A--Q--Q--Q--C--V--G--P-

----------------------------------------------------------------------------------------------------
-L--Q--T--P--L--A--D--V--A--V--V--A--L--S--H--E--E--L--I--G--A--A--T--A--L--G--E--Q--P--V--K--S--L--
CTGCAAACTCCTCTGGCAGATGTAGCGGTTGTGGCACTGAGCCATGAGGAGCTCATAGGGGCTGCCACAGCCTTGGGAGAACAGCCAGTCAAGAGCCTGC
:::::.::.:::::::: :::::.::.::::::::::::::.::. ::::::::.:::::::::::::::::.:::::::.::.::::::::::::::::
CTGCAGACCCCTCTGGCTGATGTGGCAGTTGTGGCACTGAGTCACCAGGAGCTCGTAGGGGCTGCCACAGCCCTGGGAGAGCAACCAGTCAAGAGCCTGC
-L--Q--T--P--L--A--D--V--A--V--V--A--L--S--H--Q--E--L--V--G--A--A--T--A--L--G--E--Q--P--V--K--S--L--

-------------------------------------------------------------------------------><-------------------
L--D--P--K--V--A--A--R--L--A--V--A--E--A--L--T--N--L--V--F--A--L--V--T--D--L--R--D--V--K--C--S--G--N
TGGACCCAAAAGTCGCCGCCCGGCTGGCCGTGGCCGAAGCCCTCACCAACCTGGTGTTTGCTCTGGTCACTGACCTCCGGGATGTGAAGTGTAGCGGGAA
::::::: ::.:: ::.:::::::::::::::::::::::::::::::::::::::::::::::::::::.:::::::::::::::::.::.::.:::::
TGGACCCCAAGGTGGCTGCCCGGCTGGCCGTGGCCGAAGCCCTCACCAACCTGGTGTTTGCTCTGGTCACCGACCTCCGGGATGTGAAATGCAGTGGGAA
L--D--P--K--V--A--A--R--L--A--V--A--E--A--L--T--N--L--V--F--A--L--V--T--D--L--R--D--V--K--C--S--G--N

----------------------------------------------------------------------------------------------------
--W--M--W--A--A--K--L--P--G--E--G--A--A--L--A--D--A--C--E--A--M--V--A--V--M--A--A--L--G--V--A--V--D-
CTGGATGTGGGCAGCCAAGCTCCCAGGGGAGGGCGCAGCTTTGGCGGATGCCTGTGAGGCTATGGTGGCAGTGATGGCAGCCCTGGGTGTGGCAGTGGAT
:::::::::::::::.:::::::::::::::::.::.:::.:::: ::.:::::::::::::::::::::::::::::.::::::::::::::.::::::
CTGGATGTGGGCAGCTAAGCTCCCAGGGGAGGGTGCGGCTCTGGCTGACGCCTGTGAGGCTATGGTGGCAGTGATGGCGGCCCTGGGTGTGGCGGTGGAT
--W--M--W--A--A--K--L--P--G--E--G--A--A--L--A--D--A--C--E--A--M--V--A--V--M--A--A--L--G--V--A--V--D-

------------------------------------------------------------><--------------------------------------
-G--G--K--D--S--L--S--M--A--A--R--V--G--T--E--T--V--R--A--P--G--S--L--V--I--S--A--Y--A--V--C--P--D--
GGTGGCAAGGACTCCCTCAGCATGGCTGCTCGGGTTGGCACTGAGACCGTGCGGGCTCCTGGGTCACTGGTCATCTCAGCCTATGCCGTCTGCCCAGACA
:::::::::::::::::::::::::::::.::::::::: ::::::::::::::::::::   ::.:::::::::::::::::.::.:::::.::.::::
GGTGGCAAGGACTCCCTCAGCATGGCTGCCCGGGTTGGCTCTGAGACCGTGCGGGCTCCT---TCGCTGGTCATCTCAGCCTACGCTGTCTGTCCGGACA
-G--G--K--D--S--L--S--M--A--A--R--V--G--S--E--T--V--R--A--P-----S--L--V--I--S--A--Y--A--V--C--P--D--

--------------------------------------------><------------------------------------------------------
I--T--A--T--V--T--P--D--L--K--H--P--E--G--R--G--H--L--L--Y--V--A--L--S--P--G--Q--H--R--L--G--G--T--A
TCACAGCCACTGTGACCCCAGACCTCAAGCATCCTGAAGGGAGAGGCCATCTGCTCTATGTGGCTCTGAGCCCTGGGCAGCACCGGCTCGGGGGCACAGC
:.::.::::::::::::::.:::::::::::::: :.:::::::   :.:::::::::.:: ::.:::::.::.:::::::::::::: :::::::::::
TTACGGCCACTGTGACCCCGGACCTCAAGCATCCAGGAGGGAGA---CGTCTGCTCTACGT-GCCCTGAGTCCCGGGCAGCACCGGCTGGGGGGCACAGC
I--T--A--T--V--T--P--D--L--K--H--P--G--G--R-----R--L--L--Y--V--A--L--S--P--G--Q--H--R--L--G--G--T--A

----------------------------------------------------------------------------------------------------
--L--A--Q--C--F--S--Q--L--G--E--H--P--P--D--L--D--L--P--E--N--L--V--R--A--F--S--I--T--Q--G--L--L--K-
TCTGGCCCAGTGCTTCTCCCAGCTTGGGGAACACCCTCCAGACCTGGACCTTCCTGAGAACTTGGTGCGGGCCTTCAGCATCACTCAGGGGCTGCTGAAA
::::::::::::.:::::::::::::: ::.:: ::::: ::::::::::::::::::::::::::::: :::::::.::::::.:::::::::::::::
TCTGGCCCAGTGTTTCTCCCAGCTTGGCGAGCAGCCTCCTGACCTGGACCTTCCTGAGAACTTGGTGCGTGCCTTCAACATCACCCAGGGGCTGCTGAAA
--L--A--Q--C--F--S--Q--L--G--E--Q--P--P--D--L--D--L--P--E--N--L--V--R--A--F--N--I--T--Q--G--L--L--K-

---><-----------------------------------------------------------------------------------------------
-D--R--L--L--C--S--G--H--D--V--S--D--G--G--L--V--T--C--L--L--E--M--A--F--A--G--N--C--G--L--Q--V--D--
GACCGCCTCCTCTGCTCAGGCCACGATGTCAGTGACGGAGGCCTCGTCACATGCCTGCTGGAGATGGCCTTTGCTGGAAATTGCGGGCTACAGGTGGATG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----------------------><---------------------------------------------------------------------------
V--P--V--P--R--V--D--V--L--S--V--L--F--A--E--E--P--G--L--V--L--E--V--Q--E--P--D--L--A--Q--V--L--K--R
TGCCTGTCCCCAGGGTTGATGTCCTGTCTGTGCTGTTCGCTGAGGAGCCAGGCCTCGTGCTGGAGGTGCAGGAGCCAGACCTGGCCCAGGTGCTGAAGCG
                       :::.::::::::::.::::::::::::::::: :.:.:::::::::::::::::::::::::::..::::::. .::
-----------------------CTGCCTGTGCTGTTTGCTGAGGAGCCAGGCCTGGCGTTGGAGGTGCAGGAGCCAGACCTGGCCCGAGTGCTGGCACG
------------------------L--P--V--L--F--A--E--E--P--G--L--A--L--E--V--Q--E--P--D--L--A--R--V--L--A--R

---------------------------------------------------------------------><-----------------------------
--Y--R--D--A--G--L--H--C--L--E--L--G--H--T--G--E--A--G--P--H--A--M--V--R--V--S--V--N--G--A--V--V--L-
TTACCGGGATGCTGGCCTCCATTGCCTGGAGCTGGGCCACACAGGCGAGGCCGGGCCCCACGCCATGGTCCGGGTGTCAGTGAACGGGGCTGTGGTTCTG
::::.::::. ::::::::::.:::::::::::::::..:::.::::: :::::::::::.::::::::::: .:.:::::::::::::::::::.: ::
TTACTGGGACTCTGGCCTCCACTGCCTGGAGCTGGGCTGCACGGGCGATGCCGGGCCCCATGCCATGGTCCGCATATCAGTGAACGGGGCTGTGGCTGTG
--Y--W--D--S--G--L--H--C--L--E--L--G--C--T--G--D--A--G--P--H--A--M--V--R--I--S--V--N--G--A--V--A--V-

----------------------------------------------------------------------------------------------------
-E--E--P--V--G--E--L--R--A--L--W--E--E--T--S--F--Q--L--D--R--L--Q--A--E--P--R--C--V--A--E--E--E--R--
GAGGAGCCTGTTGGGGAGCTGCGAGCCCTCTGGGAGGAGACGAGTTTCCAGCTGGACCGGCTACAGGCAGAGCCTCGCTGTGTGGCAGAGGAGGAACGGG
::::::::.::.::: .::: ::: :::: ::::::::::: :::::::::::::: :::::.:::::.::::: :. :::::::: ::.::.::.::: 
GAGGAGCCCGTCGGGCGGCTCCGATCCCTGTGGGAGGAGACCAGTTTCCAGCTGGAGCGGCTGCAGGCGGAGCCGCAGTGTGTGGCCGAAGAAGAGCGG-
-E--E--P--V--G--R--L--R--S--L--W--E--E--T--S--F--Q--L--E--R--L--Q--A--E--P--Q--C--V--A--E--E--E--R--

-----------------------------------------------------------------------------><---------------------
G--L--R--E--R--M--G--P--S--Y--C--L--P--P--T--F--P--K--A--S--V--P--R--E--P--G--G--P--S--P--R--V--A--I
GCCTGAGGGAGCGGATGGGGCCCAGCTATTGCCTGCCCCCCACCTTTCCCAAAGCCTCCGTGCCCCGTGAGCCTGGTGGTCCCAGCCCCCGAGTCGCCAT
                                                                             ::: :.. :::::::::.:::::
-----------------------------------------------------------------------------GGTGCTGCCCCCCGAGTTGCCAT
------------------------------------------------------------------------------G--A--A--P--R--V--A--I

---------------------------------------------------------------------><-----------------------------
--L--R--E--E--G--S--N--G--D--R--E--M--A--D--A--F--H--L--A--G--F--E--V--W--D--V--T--M--Q--D--L--C--S-
CTTGCGAGAGGAGGGCAGTAATGGAGACCGGGAGATGGCCGATGCCTTCCACTTAGCTGGGTTTGAGGTATGGGACGTGACCATGCAGGACCTCTGCTCT
::: :::::.::.:::::.:::::::::::::::::::::::::::::::::.:.::::::::::::::.::::::::::::::::::::::::::::::
CTTCCGAGAAGAAGGCAGCAATGGAGACCGGGAGATGGCCGATGCCTTCCACCTGGCTGGGTTTGAGGTGTGGGACGTGACCATGCAGGACCTCTGCTCT
--F--R--E--E--G--S--N--G--D--R--E--M--A--D--A--F--H--L--A--G--F--E--V--W--D--V--T--M--Q--D--L--C--S-

------------------------------------------------------------------------------------><--------------
-G--A--I--G--L--D--T--F--R--G--V--A--F--V--G--G--F--S--Y--A--D--V--L--G--S--A--K--G--W--A--A--A--V--
GGGGCAATTGGGCTGGACACTTTCCGTGGCGTGGCCTTCGTGGGCGGCTTCAGCTATGCAGATGTCCTGGGCTCTGCCAAAGGGTGGGCAGCTGCTGTGA
::.:::::::: :::::::: ::::: :: :.::::::::::::::::::::::::::: ::::: :::::::::::::::   :::::::::::.::::
GGAGCAATTGGCCTGGACACGTTCCGGGGAGCGGCCTTCGTGGGCGGCTTCAGCTATGCCGATGTACTGGGCTCTGCCAAA---TGGGCAGCTGCCGTGA
-G--A--I--G--L--D--T--F--R--G--A--A--F--V--G--G--F--S--Y--A--D--V--L--G--S--A--K-----W--A--A--A--V--

----------------------------------------------------------------------------------------------------
T--F--H--P--R--A--G--A--E--L--R--R--F--R--K--R--P--D--T--F--S--L--G--V--C--N--G--C--Q--L--L--A--L--L
CCTTTCATCCCAGGGCTGGGGCTGAGCTGAGGCGCTTCCGGAAGCGGCCAGACACCTTCAGCCTGGGCGTGTGTAATGGCTGTCAACTGCTGGCTCTGCT
::::: :.::  ::::.::::::::::::::::::::::::.::::::::::::::::::::::::::::::::::.:::::.::.::::::::::::::
CCTTTAACCCACGGGCCGGGGCTGAGCTGAGGCGCTTCCGGGAGCGGCCAGACACCTTCAGCCTGGGCGTGTGTAACGGCTGCCAGCTGCTGGCTCTGCT
T--F--N--P--R--A--G--A--E--L--R--R--F--R--E--R--P--D--T--F--S--L--G--V--C--N--G--C--Q--L--L--A--L--L

----------------------------------------------------------------------------------------------------
--G--W--V--G--G--D--P--N--E--D--A--A--E--M--G--P--D--S--Q--P--A--R--P--G--L--L--L--R-----H--N--L--S-
CGGCTGGGTGGGAGGCGACCCCAATGAGGATGCTGCAGAGATGGGCCCTGACTCCCAGCCAGCCCGGCCAGGCCTTCTGCTACGC---CACAACCTGTCT
 :::::::::::::::...:::.. ::::: :: ::::::: :::::  ::.:::..:::::::::::: :::::.:::::.:::   ::::::::::: 
GGGCTGGGTGGGAGGCAGTCCCGGGGAGGAGGCAGCAGAGAGGGGCCAGGATTCCTGGCCAGCCCGGCCCGGCCTCCTGCTGCGCC--CACAACCTGTCG
--G--W--V--G--G--S--P--G--E--E--A--A--E--R--G--Q--D--S--W--P--A--R--P--G--L--L--L--R--\--H--N--L--S-

----------------------------------------------------------------------------------------------------
-G--R--Y--E--S--R--W--A--S--V--R--V--G--P--G--P--A--L--M--L--R--G--M--E--G--A--V--L--P--V--W--S--A--
GGGCGCTACGAGTCTCGCTGGGCCAGCGTGCGTGTGGGGCCTGGGCCAGCCCTGATGCTGCGAGGGATGGAGGGCGCCGTGCTGCCCGTGTGGAGTGCGC
:::::.::.::::: :::::::::::::::::::::::.::.:::::::::::::::::::::::::::::::::::::::::::::::::::::.:: :
GGGCGTTATGAGTCACGCTGGGCCAGCGTGCGTGTGGGACCCGGGCCAGCCCTGATGCTGCGAGGGATGGAGGGCGCCGTGCTGCCCGTGTGGAGCGCTC
-G--R--Y--E--S--R--W--A--S--V--R--V--G--P--G--P--A--L--M--L--R--G--M--E--G--A--V--L--P--V--W--S--A--

-----------><---------------------------------------------------------------------------------------
H--G--E--G--Y--V--A--F--S--S--P--E--L--Q--A--Q--I--E--A--R--G--L--A--P--L--H--W--A--D--D--D--G--N--P
ACGGGGAAGGTTACGTAGCATTTTCTTCTCCGGAACTCCAAGCTCAGATTGAGGCCAGGGGCTTGGCTCCACTGCACTGGGCTGATGATGACGGGAACCC
::::::::   :::.:.::::::::.:::::.:::::::::::.:::::.::::::.:::::::::::::.::::::::::: ::.:::::.::::::::
ACGGGGAA---TACATGGCATTTTCCTCTCCAGAACTCCAAGCCCAGATCGAGGCCGGGGGCTTGGCTCCGCTGCACTGGGCAGACGATGATGGGAACCC
H--G--E-----Y--M--A--F--S--S--P--E--L--Q--A--Q--I--E--A--G--G--L--A--P--L--H--W--A--D--D--D--G--N--P

----------------------------------------------------------------------------------------------------
--T--E--Q--Y--P--L--N--P--N--G--S--P--G--G--V--A--G--I--C--S--C--D--G--R--H--L--A--V--M--P--H--P--E-
CACAGAGCAGTACCCTCTGAATCCCAATGGGTCCCCAGGGGGCGTGGCTGGCATCTGCTCCTGTGATGGCCGCCACCTGGCTGTCATGCCTCACCCTGAG
::::::.::::::::.:::::::::::.::::::::::::::::::::::::.::::::::. :::.::::::::::::::: ::::::: :::::::::
CACAGAACAGTACCCCCTGAATCCCAACGGGTCCCCAGGGGGCGTGGCTGGCGTCTGCTCCCCTGACGGCCGCCACCTGGCTCTCATGCCGCACCCTGAG
--T--E--Q--Y--P--L--N--P--N--G--S--P--G--G--V--A--G--V--C--S--P--D--G--R--H--L--A--L--M--P--H--P--E-

----------------------------------------------------------------------------------------------------
-R--A--V--R--P--W--Q--W--A--W--R--P--P--P--F--D--T--L--T--T--S--P--W--L--Q--L--F--I--N--A--R--N--W--
CGGGCCGTTAGGCCTTGGCAGTGGGCATGGCGACCCCCTCCATTTGATACTCTGACCACCTCCCCCTGGCTCCAGCTCTTTATCAATGCCCGAAACTGGA
::: :.::  ::::::::::::::::::::::.::.::::: :::::.:: :::.::::::: :::::::::::::::::..:.::::::::::: ::::
CGGTCTGTGCGGCCTTGGCAGTGGGCATGGCGGCCTCCTCCCTTTGACACGCTGGCCACCTCGCCCTGGCTCCAGCTCTTCGTTAATGCCCGAAAATGGA
-R--S--V--R--P--W--Q--W--A--W--R--P--P--P--F--D--T--L--A--T--S--P--W--L--Q--L--F--V--N--A--R--K--W--

--------------------
T--L--E--G--S--C--*-
CCCTGGAAGGGAGCTGCTGA
::: ::::::..::::::::
CCCAGGAAGGAGGCTGCTGA
T--Q--E--G--G--C--*-

Pig Consensus Sequence

>BGISUST0000881683
ATGTCCTCAGTCCTTCACTTTTTTGTGCGTCCCTCTGGCCACGAGGGGGCAGCCTCTGCATACACACAAAGGAAGCTGCGAGGGGAACTGCCAGCGCTGC
AGGGTATCAAGACTGAGTTGTGCTACAACGTGAACTGGACA---GAGTCCTTCCCAAGCGCCGAGGAGATGAAGAAACTGACCTGGCTGTTTGGCTGCCC
CTTGTTACTGGACGATGTTGCTCAGGAGTCCTGGCTCCTTCCCGGCTCCAATGACCTGCTGCTGGAGGTCGGGCCC------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
------------------------------------------------GAAGCCCCCTTCAGCGGTGCAACCACTGGCACAGGGGGCCGGATCCGTGACG
TCCAGTGTACAGGCCGCGGGGCGCATGTGGTGGCTGGCACTGCTGGCTATTGCTTTGGAAACCTGCACGTCCCA--------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
--------------------------------------ATGGATGTTGTGAAGGTGGGGGGTCCTGTCTACAGGATTGGAGTTGGGGGCGGGGCCGCTTT
ATCTGTGCAGGTACAGGGAGACAACGCCAGCAACCTGGACTTTGGGGCTGTGCAGCGAGGGGACCCAGAGATGGAACAGAAGATGAACCGCGTGATCCGA
GCTTGTGTGGAGGCCCCCAGGGGAAACCCCATCTGCAGCCTCCATGACCAGGGCGCCGGTGGCAAT----------------------------------
--------------------------------------------------------------------------TACCAGGAGTCAAATGCGCTTCTGCT
GAGGCCCCCCGACCGGGACTTCCTGATGCGTGTCAGCGCCCGGGAACGCAGCCCGGCTTGCTTTGTGGGCACCATCACCGGAGATGGGAGAATAGTGCTG
GTGGATGACCAGGAGGGTCCTGTGGGAAGAGATGGCCAGGGGGATGCCCCCCCG----------------------------------------------
----------------------------------------------------------------------------------------------------
-------------------------------------------------GTGGACCGCTCTGTGAGCGGCTTGGTGGCACAGCAGCAGTGTGTGGGACCC
CTGCAGACCCCTCTGGCTGATGTGGCAGTTGTGGCACTGAGTCACCAGGAGCTCGTAGGGGCTGCCACAGCCCTGGGAGAGCAACCAGTCAAGAGCCTGC
TGGACCCCAAGGTGGCTGCCCGGCTGGCCGTGGCCGAAGCCCTCACCAACCTGGTGTTTGCTCTGGTCACCGACCTCCGGGATGTGAAATGCAGTGGGAA
CTGGATGTGGGCAGCTAAGCTCCCAGGGGAGGGTGCGGCTCTGGCTGACGCCTGTGAGGCTATGGTGGCAGTGATGGCGGCCCTGGGTGTGGCGGTGGAT
GGTGGCAAGGACTCCCTCAGCATGGCTGCCCGGGTTGGCTCTGAGACCGTGCGGGCTCCT---TCGCTGGTCATCTCAGCCTACGCTGTCTGTCCGGACA
TTACGGCCACTGTGACCCCGGACCTCAAGCATCCAGGAGGGAGA---CGTCTGCTCTAcgCCCTGAGTCCCGGGCAGCACCGGCTGGGGGGCACAGCTCT
GGCCCAGTGTTTCTCCCAGCTTGGCGAGCAGCCTCCTGACCTGGACCTTCCTGAGAACTTGGTGCGTGCCTTCAACATCACCCAGGGGCTGCTGAAA---
----------------------------------------------------------------------------------------------------
--------------------CTGCCTGTGCTGTTTGCTGAGGAGCCAGGCCTGGCGTTGGAGGTGCAGGAGCCAGACCTGGCCCGAGTGCTGGCACGTTA
CTGGGACTCTGGCCTCCACTGCCTGGAGCTGGGCTGCACGGGCGATGCCGGGCCCCATGCCATGGTCCGCATATCAGTGAACGGGGCTGTGGCTGTGGAG
GAGCCCGTCGGGCGGCTCCGATCCCTGTGGGAGGAGACCAGTTTCCAGCTGGAGCGGCTGCAGGCGGAGCCGCAGTGTGTGGCCGAAGAAGAGCGG----
--------------------------------------------------------------------------GGTGCTGCCCCCCGAGTTGCCATCTT
CCGAGAAGAAGGCAGCAATGGAGACCGGGAGATGGCCGATGCCTTCCACCTGGCTGGGTTTGAGGTGTGGGACGTGACCATGCAGGACCTCTGCTCTGGA
GCAATTGGCCTGGACACGTTCCGGGGAGCGGCCTTCGTGGGCGGCTTCAGCTATGCCGATGTACTGGGCTCTGCCAAA---TGGGCAGCTGCCGTGACCT
TTAACCCACGGGCCGGGGCTGAGCTGAGGCGCTTCCGGGAGCGGCCAGACACCTTCAGCCTGGGCGTGTGTAACGGCTGCCAGCTGCTGGCTCTGCTGGG
CTGGGTGGGAGGCAGTCCCGGGGAGGAGGCAGCAGAGAGGGGCCAGGATTCCTGGCCAGCCCGGCCCGGCCTCCTGCTGCGccACAACCTGTCGGGGCGT
TATGAGTCACGCTGGGCCAGCGTGCGTGTGGGACCCGGGCCAGCCCTGATGCTGCGAGGGATGGAGGGCGCCGTGCTGCCCGTGTGGAGCGCTCACGGGG
AA---TACATGGCATTTTCCTCTCCAGAACTCCAAGCCCAGATCGAGGCCGGGGGCTTGGCTCCGCTGCACTGGGCAGACGATGATGGGAACCCCACAGA
ACAGTACCCCCTGAATCCCAACGGGTCCCCAGGGGGCGTGGCTGGCGTCTGCTCCCCTGACGGCCGCCACCTGGCTCTCATGCCGCACCCTGAGCGGTCT
GTGCGGCCTTGGCAGTGGGCATGGCGGCCTCCTCCCTTTGACACGCTGGCCACCTCGCCCTGGCTCCAGCTCTTCGTTAATGCCCGAAAATGGACCCAGG
AAGGAGGCTGCTGA


>BGISUSP0000881683
MSSVLHFFVRPSGHEGAASAYTQRKLRGELPALQGIKTELCYNVNWT-ESFPSAEEMKKLTWLFGCPLLLDDVAQESWLLPGSNDLLLEVGP--------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------EAPFSGATTGTGGRIRDVQCTGRGAHVVAGTAGYCFGNLHVP------------------------------------------
----------------------------------------------MDVVKVGGPVYRIGVGGGAALSVQVQGDNASNLDFGAVQRGDPEMEQKMNRVIR
ACVEAPRGNPICSLHDQGAGGN------------------------------------YQESNALLLRPPDRDFLMRVSARERSPACFVGTITGDGRIVL
VDDQEGPVGRDGQGDAPP-----------------------------------------------------------------VDRSVSGLVAQQQCVGP
LQTPLADVAVVALSHQELVGAATALGEQPVKSLLDPKVAARLAVAEALTNLVFALVTDLRDVKCSGNWMWAAKLPGEGAALADACEAMVAVMAALGVAVD
GGKDSLSMAARVGSETVRAP-SLVISAYAVCPDITATVTPDLKHPGGR-RLLYALSPGQHRLGGTALAQCFSQLGEQPPDLDLPENLVRAFNITQGLLK-
----------------------------------------LPVLFAEEPGLALEVQEPDLARVLARYWDSGLHCLELGCTGDAGPHAMVRISVNGAVAVE
EPVGRLRSLWEETSFQLERLQAEPQCVAEEER--------------------------GAAPRVAIFREEGSNGDREMADAFHLAGFEVWDVTMQDLCSG
AIGLDTFRGAAFVGGFSYADVLGSAK-WAAAVTFNPRAGAELRRFRERPDTFSLGVCNGCQLLALLGWVGGSPGEEAAERGQDSWPARPGLLLRHNLSGR
YESRWASVRVGPGPALMLRGMEGAVLPVWSAHGE-YMAFSSPELQAQIEAGGLAPLHWADDDGNPTEQYPLNPNGSPGGVAGVCSPDGRHLALMPHPERS
VRPWQWAWRPPPFDTLATSPWLQLFVNARKWTQEGGC*