Sequences
CT187969reads
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000177873 (click for geneview)
Transcript ID ENST00000314686(link to ensembl)
Symbol ZNF619
Localtion Chromosome:3:40498432:40504736:1 band: 3p22.1
Description zinc finger protein 619 [Source:RefSeq_peptide;Acc:NP_775927]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<------------------------------------------------------------------------------><-------------------
-M--G--Q--P--A--P--Y--A--E--G--P--I--Q--G--G--D--A--G--E--L--C--K--C--D--F--L--V--S--I--S--I--P--Q--
ATGGGCCAGCCTGCACCCTACGCAGAGGGCCCTATACAGGGAGGTGATGCTGGAGAATTATGCAAATGTGACTTCCTTGTCAGCATTTCCATTCCCCAAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------------------------------------------------------------------------------------------><--
T--R--S--D--I--P--A--G--A--R--R--S--S--M--G--P--R--S--L--D--T--C--W--G--R--G--P--E--R--H--V--H--R--L
CCAGATCTGATATTCCAGCTGGAGCAAGGAGAAGCAGCATGGGGCCCAGATCCCTGGACACTTGCTGGGGGAGAGGCCCTGAGAGGCATGTGCACAGGCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------><----------------------------------------------------
--E--C--N--G--V--I--F--T--H--R--N--L--C--L--P--G--G--K--T--K--T--E--N--E--E--K--T--A--Q--L--N--I--S-
GGAGTGCAATGGCGTGATCTTCACTCACCGCAACCTCTGCCTTCCAGGTGGTAAAACCAAGACTGAGAATGAGGAAAAAACTGCACAGCTAAACATTTCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-K--E--S--E--S--H--R--L--I--V--E--G--L--L--M--D--V--P--Q--H--P--D--F--K--D--R--L--E--K--S--Q--L--H--
AAAGAATCAGAGTCCCACAGACTGATAGTGGAGGGACTGCTGATGGACGTTCCCCAGCACCCTGACTTCAAGGACAGGTTAGAGAAGTCACAGCTACATG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
D--T--G--N--K--T--K--I--G--D--C--T--D--L--T--V--Q--D--H--E--S--S--T--T--E--R--E--E--I--A--R--K--L--E
ATACAGGGAATAAAACAAAGATAGGGGATTGCACAGATTTGACAGTCCAGGATCATGAATCTTCCACCACTGAAAGGGAGGAGATAGCCAGGAAATTGGA
                                                                          ::.::::.: : :::::. ::.::::
--------------------------------------------------------------------------AGAGAGGGGTTCGCCAGACAACTGGA
---------------------------------------------------------------------------R--E--G--F--A--R--Q--L--E

----------------------------------------------------------------------------------------------------
--E--S-----S--V--S--T--H--L--I--T--K--Q--G--F--A--K--E--Q--V--F--Y--K--C--G--E--C--G--S--Y--Y--N--P-
AGAAAGT---AGTGTCAGCACACATCTCATTACAAAGCAGGGTTTTGCCAAAGAACAGGTGTTTTATAAATGTGGTGAGTGTGGCAGTTACTACAACCCA
::.:::.   .::::: .::::::::::::::::::::::::..:. :::.:::::.:::.::::::::::::::::.::::::::: ::.: :::.: :
AGGAAGCTGTGGTGTCCACACACATCTCATTACAAAGCAGGGCCTCTCCAGAGAACGGGTATTTTATAAATGTGGTGGGTGTGGCAGATATTTCAATCAA
--G--S--C--G--V--H--T--H--L--I--T--K--Q--G--L--S--R--E--R--V--F--Y--K--C--G--G--C--G--R--Y--F--N--Q-

----------------------------------------------------------------------------------------------------
-H--S--D--F--H--L--H--Q--R--V--H--T--N--E--K--P--Y--T--C--K--E--C--G--K--T--F--R--Y--N--S--K--L--S--
CATTCAGACTTTCACCTGCATCAGAGAGTTCACACTAATGAGAAGCCCTACACATGCAAAGAATGTGGGAAAACCTTCAGATATAACTCAAAACTGTCAC
:::::::::.::.::: ::::::::::.::::::. .:..:::::::.:::: :::.:::::::::::::::.::::::: ::.:::::::::::.::::
CATTCAGACCTTTACCAGCATCAGAGAATTCACATGGACAAGAAGCCTTACAAATGTAAAGAATGTGGGAAAGCCTTCAGCTACAACTCAAAACTATCAC
-H--S--D--L--Y--Q--H--Q--R--I--H--M--D--K--K--P--Y--K--C--K--E--C--G--K--A--F--S--Y--N--S--K--L--S--

----------------------------------------------------------------------------------------------------
R--H--Q--K--I--H--T--G--E--K--P--Y--S--C--E--E--C--G--Q--A--F--S--Q--N--S--H--L--L--Q--H--Q--K--L--H
GGCATCAGAAAATCCACACTGGAGAGAAACCATACTCATGTGAGGAATGTGGACAAGCCTTCAGTCAAAATTCCCACCTTCTTCAGCATCAGAAGCTCCA
::::::::::::::::::::::.::.::::::::::::::. :: :.:::::::::::::::::::::::.:::::: :.::::::::::::::.:::::
GGCATCAGAAAATCCACACTGGGGAAAAACCATACTCATGCCAGCAGTGTGGACAAGCCTTCAGTCAAAACTCCCACGTCCTTCAGCATCAGAAACTCCA
R--H--Q--K--I--H--T--G--E--K--P--Y--S--C--Q--Q--C--G--Q--A--F--S--Q--N--S--H--V--L--Q--H--Q--K--L--H

----------------------------------------------------------------------------------------------------
--G--G--Q--R--P--Y--E--C--T--D--C--G--K--T--F--S--Y--N--S--K--L--I--R--H--Q--R--I--H--T--G--E--K--P-
TGGTGGACAGAGGCCCTATGAATGTACTGACTGTGGTAAAACCTTCAGTTATAATTCAAAACTGATTCGGCATCAGAGAATCCATACTGGGGAGAAGCCC
::  ::: :::.:::::::: :::::  :: ::::: :::::::::::.::.::.:::::::: ::. :::::::: :::::::.::::: ::.::.:::
TGTGGGAGAGAAGCCCTATGCATGTAAGGAGTGTGGGAAAACCTTCAGCTACAACTCAAAACTTATCAGGCATCAGCGAATCCACACTGGTGAAAAACCC
--V--G--E--K--P--Y--A--C--K--E--C--G--K--T--F--S--Y--N--S--K--L--I--R--H--Q--R--I--H--T--G--E--K--P-

----------------------------------------------------------------------------------------------------
-F--K--C--K--E--C--G--K--A--F--S--C--S--Y--D--C--I--I--H--E--R--I--H--N--G--E--K--P--Y--E--C--K--E--
TTTAAATGTAAGGAATGTGGGAAAGCCTTCAGTTGTAGCTATGACTGCATCATCCATGAACGAATTCACAATGGGGAGAAGCCCTATGAATGTAAGGAGT
::::::::::::::.::::::::.::.::: : ::::::::::::::.::.::::::::.:::::.:::: ::: :::::::::::.::.::::::::::
TTTAAATGTAAGGAGTGTGGGAAGGCTTTCCGGTGTAGCTATGACTGTATTATCCATGAGCGAATCCACACTGGCGAGAAGCCCTACGAGTGTAAGGAGT
-F--K--C--K--E--C--G--K--A--F--R--C--S--Y--D--C--I--I--H--E--R--I--H--T--G--E--K--P--Y--E--C--K--E--

----------------------------------------------------------------------------------------------------
C--G--K--S--L--S--S--N--S--V--L--I--Q--H--Q--R--I--H--T--G--E--K--P--Y--E--C--K--E--C--G--K--A--F--H
GTGGGAAGAGTTTGAGTTCTAATTCAGTTCTGATTCAGCATCAGAGAATCCACACTGGGGAGAAACCTTATGAATGTAAAGAGTGTGGCAAGGCCTTCCA
:::::::.:..:: ::::: ::::::::.::::::::::::::::::::::::::::::::::::::::::::.::::::::::::::::::::::::::
GTGGGAAAAACTTCAGTTCAAATTCAGTCCTGATTCAGCATCAGAGAATCCACACTGGGGAGAAACCTTATGAGTGTAAAGAGTGTGGCAAGGCCTTCCA
C--G--K--N--F--S--S--N--S--V--L--I--Q--H--Q--R--I--H--T--G--E--K--P--Y--E--C--K--E--C--G--K--A--F--H

----------------------------------------------------------------------------------------------------
--R--S--S--V--F--L--Q--H--Q--R--F--H--T--G--E--Q--L--Y--K--C--N--E--C--W--K--T--F--S--C--S--S--R--F-
CCGCAGTTCGGTATTTCTTCAGCACCAGAGGTTCCACACTGGGGAACAACTCTACAAATGTAATGAATGTTGGAAAACTTTCAGCTGTAGCTCCCGCTTC
::: ::.::.:. ::.:: ::::::::::::::::::::::::::: :::::::.:::::::::::::::::::::::::::::.:::::::: :::.:.
CCGGAGCTCAGCCTTCCTGCAGCACCAGAGGTTCCACACTGGGGAAAAACTCTATAAATGTAATGAATGTTGGAAAACTTTCAGTTGTAGCTCACGCCTT
--R--S--S--A--F--L--Q--H--Q--R--F--H--T--G--E--K--L--Y--K--C--N--E--C--W--K--T--F--S--C--S--S--R--L-

----------------------------------------------------------------------------------------------------
-I--V--H--Q--R--I--H--N--G--E--K--P--Y--E--C--Q--E--C--G--K--T--F--S--Q--K--I--T--L--V--Q--H--Q--R--
ATAGTGCATCAGAGAATCCACAATGGGGAGAAACCCTATGAATGCCAGGAATGTGGGAAGACATTCAGTCAAAAGATCACTCTGGTTCAGCATCAGCGAG
:.:::.::::::::::::::::  :::::::.:::..:::::::::::::.::::::                                           
ACAGTACATCAGAGAATCCACACAGGGGAGAGACCTCATGAATGCCAGGAGTGTGGG-------------------------------------------
-T--V--H--Q--R--I--H--T--G--E--R--P--H--E--C--Q--E--C--G--------------------------------------------

----------------------------------------------------------------------------------------------------
V--H--T--G--E--K--P--Y--E--C--K--E--C--G--K--A--F--R--W--N--A--S--F--I--Q--H--Q--K--W--H--T--R--K--K
TTCACACTGGGGAGAAACCTTATGAGTGTAAGGAGTGCGGGAAAGCCTTCAGATGGAATGCAAGTTTCATCCAGCATCAGAAGTGGCATACTAGGAAGAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--L--I--N--G--T--G--L--S--A--V--K--P--Y--C--P--C--A--I--L--S--P--L--P--P--Q--H--T--C--S--A--L--A--P-
ACTCATCAATGGAACAGGGCTATCCGCAGTTAAGCCCTACTGTCCCTGCGCCATCCTCTCTCCTCTGCCTCCCCAACATACCTGCTCTGCCCTAGCCCCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-P--G--P--P--L--S--S--S--H--A--V--V--L--P--P--S--V--P--F--F--L--L--L--P--S--S--E--K--A--N--P--S--P--
CCAGGGCCTCCCTTATCTTCTTCACATGCAGTGGTACTTCCTCCCTCTGTGCCTTTCTTCCTGCTGCTTCCCTCATCTGAAAAGGCCAACCCTTCACCTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------------------------------------------------------------------------------->
V--Q--I--A--H--F--F--Q--D--L--A--F--P--G--K--S--S--L--Q--S--P--N--P--L--S--H--S--L--*-
TCCAAATAGCACATTTTTTTCAGGATCTCGCTTTTCCTGGGAAGTCATCCCTTCAGAGCCCGAATCCTTTGTCTCACTCCCTGTAA
                                                                                      
--------------------------------------------------------------------------------------
--------------------------------------------------------------------------------------

Pig Consensus Sequence

>BGISUST0000882050
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
--------------------------------------------------------------------------AGAGAGGGGTTCGCCAGACAACTGGA
AGGAAGCTGTGGTGTCCACACACATCTCATTACAAAGCAGGGCCTCTCCAGAGAACGGGTATTTTATAAATGTGGTGGGTGTGGCAGATATTTCAATCAA
CATTCAGACCTTTACCAGCATCAGAGAATTCACATGGACAAGAAGCCTTACAAATGTAAAGAATGTGGGAAAGCCTTCAGCTACAACTCAAAACTATCAC
GGCATCAGAAAATCCACACTGGGGAAAAACCATACTCATGCCAGCAGTGTGGACAAGCCTTCAGTCAAAACTCCCACGTCCTTCAGCATCAGAAACTCCA
TGTGGGAGAGAAGCCCTATGCATGTAAGGAGTGTGGGAAAACCTTCAGCTACAACTCAAAACTTATCAGGCATCAGCGAATCCACACTGGTGAAAAACCC
TTTAAATGTAAGGAGTGTGGGAAGGCTTTCCGGTGTAGCTATGACTGTATTATCCATGAGCGAATCCACACTGGCGAGAAGCCCTACGAGTGTAAGGAGT
GTGGGAAAAACTTCAGTTCAAATTCAGTCCTGATTCAGCATCAGAGAATCCACACTGGGGAGAAACCTTATGAGTGTAAAGAGTGTGGCAAGGCCTTCCA
CCGGAGCTCAGCCTTCCTGCAGCACCAGAGGTTCCACACTGGGGAAAAACTCTATAAATGTAATGAATGTTGGAAAACTTTCAGTTGTAGCTCACGCCTT
ACAGTACATCAGAGAATCCACACAGGGGAGAGACCTCATGAATGCCAGGAGTGT----------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-----------------------------------------------------------------------------------


>BGISUSP0000882050
----------------------------------------------------------------------------------------------------
----------------------------------------------------------REGFARQLEGSCGVHTHLITKQGLSRERVFYKCGGCGRYFNQ
HSDLYQHQRIHMDKKPYKCKECGKAFSYNSKLSRHQKIHTGEKPYSCQQCGQAFSQNSHVLQHQKLHVGEKPYACKECGKTFSYNSKLIRHQRIHTGEKP
FKCKECGKAFRCSYDCIIHERIHTGEKPYECKECGKNFSSNSVLIQHQRIHTGEKPYECKECGKAFHRSSAFLQHQRFHTGEKLYKCNECWKTFSCSSRL
TVHQRIHTGERPHECQEC----------------------------------------------------------------------------------
-------------------------------------------------------------