Sequences
EST Library Info
cbl2Blood
cly3Lymph - RNA from China
ecc2Foetus 50 days, cortex cerebri
eje1Foetus 50 days, jejunum
eru1Foetus 50 days, regio umbilicalis
fce2Foetus 100 days, cerebellum
hyp2Hypothalamus
pgl1Pituitary gland
pigcb1Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000106263 (click for geneview)
Transcript ID ENST00000314800(link to ensembl)
Symbol EIF3S9
Localtion Chromosome:7:2167798:2193616:1 band: 7p22.3
Description Eukaryotic translation initiation factor 3 subunit 9 (eIF-3 eta) (eIF3 p116) (eIF3 p110) (eIF3b). [Source:Uniprot/SWISSPROT;Acc:P55884]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--Q--D--A--E--N--V--A--V--P--E--A--A--E--E--R--A--E--P--G--Q--Q--Q--P--A--A--E--P--P--P--A--E--G--
ATGCAGGACGCGGAGAACGTGGCGGTGCCCGAGGCGGCCGAGGAGCGCGCCGAGCCCGGCCAGCAGCAGCCGGCCGCCGAGCCGCCGCCAGCCGAGGGGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
L--L--R--P--A--G--P--G--A--P--E--A--A--G--T--E--A--S--S--E--E--V--G--I--A--E--A--G--P--E--S--E--V--R
TGCTGCGGCCCGCGGGGCCCGGCGCTCCGGAGGCCGCGGGGACCGAGGCCTCCAGTGAGGAGGTGGGGATCGCGGAGGCCGGGCCGGAGTCCGAGGTGAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--T--E--P--A--A--E--A--E--A--A--S--G--P--S--E--S--P--S--P--P--A--A--E--E--L--P--G--S--H--A--E--P--P-
GACCGAGCCGGCGGCCGAGGCAGAGGCGGCCTCCGGCCCGTCCGAGTCGCCCTCGCCGCCGGCCGCCGAGGAGCTGCCCGGGTCGCATGCTGAGCCCCCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-V--P--A--Q--G--E--A--P--G--E--Q--A--R--D--E--R--S--D--S--R--A--Q--A--V--S--E--D--A--G--G--N--E--G--
GTCCCGGCACAGGGCGAGGCCCCAGGAGAGCAGGCTCGGGACGAGCGCTCCGACAGCCGGGCCCAGGCGGTGTCCGAGGACGCGGGAGGAAACGAGGGCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------------------------------------------------------------------------------------><
R--A--A--E--A--E--P--R--A--L--E--N--G--D--A--D--E--P--S--F--S--D--P--E--D--F--V--D--D--V--S--E--E--E
GAGCGGCCGAGGCCGAACCCCGGGCGCTGGAGAACGGCGACGCGGACGAGCCCTCCTTCAGCGACCCCGAGGACTTCGTGGACGACGTGAGCGAGGAAGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--L--L--G--D--V--L--K--D--R--P--Q--E--A--D--G--I--D--S--V--I--V--V--D--N--V--P--Q--V--G--P--D--R--L-
ATTACTGGGAGATGTACTCAAAGATCGGCCCCAGGAAGCAGATGGAATCGATTCGGTGATTGTAGTGGACAATGTCCCTCAGGTGGGACCCGACCGACTT
 :::::::::::.::::::::::::::::: :::::::::::.::.::.:::::::: ::.::.::::::::.::::: :::::::::::.::::: :: 
-TTACTGGGAGACGTACTCAAAGATCGGCCGCAGGAAGCAGACGGGATTGATTCGGTCATCGTGGTGGACAACGTCCCGCAGGTGGGACCTGACCGTCTG
--L--L--G--D--V--L--K--D--R--P--Q--E--A--D--G--I--D--S--V--I--V--V--D--N--V--P--Q--V--G--P--D--R--L-

-------------------------------------------------------------------------------------------><-------
-E--K--L--K--N--V--I--H--K--I--F--S--K--F--G--K--I--T--N--D--F--Y--P--E--E--D--G--K--T--K--G--Y--I--
GAGAAACTCAAAAATGTCATCCACAAGATCTTTTCCAAGTTTGGGAAAATCACAAATGATTTTTATCCTGAAGAGGATGGGAAGACAAAAGGGTATATTT
::::::::::::::.::::::::.::::::::.::::::::::::::::::::.::.::.:::::::: ::.:::::.::.:.::: :::          
GAGAAACTCAAAAACGTCATCCATAAGATCTTCTCCAAGTTTGGGAAAATCACGAACGACTTTTATCCGGAGGAGGACGGAAGGACCAAA----------
-E--K--L--K--N--V--I--H--K--I--F--S--K--F--G--K--I--T--N--D--F--Y--P--E--E--D--G--R--T--K-----------

----------------------------------------------------------------------------------------------------
F--L--E--Y--A--S--P--A--H--A--V--D--A--V--K--N--A--D--G--Y--K--L--D--K--Q--H--T--F--R--V--N--L--F--T
TCCTGGAGTACGCGTCCCCTGCCCACGCTGTGGATGCTGTGAAGAACGCCGACGGCTACAAGCTTGACAAGCAGCACACATTCCGGGTCAACCTCTTTAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----------><--------------------------------------------------------><-----------------------------
--D--F--D--K--Y--M--T--I--S--D--E--W--D--I--P--E--K--Q--P--F--K--D--L--G--N--L--R--Y--W--L--E--E--A-
GGATTTTGACAAGTATATGACGATCAGTGACGAGTGGGATATTCCAGAGAAACAGCCTTTCAAAGACCTGGGGAACTTACGTTACTGGCTTGAAGAGGCA
             ::.::::: :::::.:::::.:::::.:::::::::::.::::::::::::::::::::::::::::::::::::::.::.:::::.
-------------TACATGACCATCAGCGACGAATGGGACATTCCAGAGAAGCAGCCTTTCAAAGACCTGGGGAACTTACGTTACTGGCTCGAGGAGGCG
--------------Y--M--T--I--S--D--E--W--D--I--P--E--K--Q--P--F--K--D--L--G--N--L--R--Y--W--L--E--E--A-

--------------------------------------------------------------------------------------------------><
-E--C--R--D--Q--Y--S--V--I--F--E--S--G--D--R--T--S--I--F--W--N--D--V--K--D--P--V--S--I--E--E--R--A--
GAATGCAGAGATCAGTACAGTGTGATTTTTGAGAGTGGAGACCGCACTTCCATATTCTGGAATGACGTAAAAGACCCTGTCTCAATTGAAGAAAGAGCGA
::.::: :::::::::::::.:::::::::::::::::::::::::: ::::::::::::::.::::: ::.:.:::.:: :: ::::::::.:::::: 
GAGTGCCGAGATCAGTACAGCGTGATTTTTGAGAGTGGAGACCGCACGTCCATATTCTGGAACGACGTCAAGGGCCCCGTGTCCATTGAAGAGAGAGCG-
-E--C--R--D--Q--Y--S--V--I--F--E--S--G--D--R--T--S--I--F--W--N--D--V--K--G--P--V--S--I--E--E--R--A--

----------------------------------------------------------------------------------------------------
R--W--T--E--T--Y--V--R--W--S--P--K--G--T--Y--L--A--T--F--H--Q--R--G--I--A--L--W--G--G--E--K--F--K--Q
GATGGACAGAGACGTATGTGCGTTGGTCTCCTAAGGGCACCTACCTGGCTACCTTTCATCAAAGAGGCATTGCTCTATGGGGGGGAGAGAAATTCAAGCA
  ::::::::::: ::.:::::::::::.:::::::::::::::::::: :::::::::::. ::::::::::::: :::::.::::::::::::::.::
--TGGACAGAGACCTACGTGCGTTGGTCCCCTAAGGGCACCTACCTGGCGACCTTTCATCAGCGAGGCATTGCTCTCTGGGGAGGAGAGAAATTCAAACA
---W--T--E--T--Y--V--R--W--S--P--K--G--T--Y--L--A--T--F--H--Q--R--G--I--A--L--W--G--G--E--K--F--K--Q

--------------------------------------------------------><------------------------------------------
--I--Q--R--F--S--H--Q--G--V--Q--L--I--D--F--S--P--C--E--R--Y--L--V--T--F--S--P--L--M--D--T--Q--D--D-
AATTCAGAGATTCAGCCACCAAGGGGTTCAGCTTATTGACTTCTCACCTTGTGAAAGGTACCTGGTGACCTTTAGCCCCCTGATGGACACGCAGGATGAC
.::.:::::::::::::::::::::::.:::::.::.::::::::.:: ::::::   :::::::::::.::.::::::::::::::::: :::::.:::
GATCCAGAGATTCAGCCACCAAGGGGTCCAGCTCATCGACTTCTCGCCGTGTGAA---TACCTGGTGACTTTCAGCCCCCTGATGGACACTCAGGACGAC
--I--Q--R--F--S--H--Q--G--V--Q--L--I--D--F--S--P--C--E-----Y--L--V--T--F--S--P--L--M--D--T--Q--D--D-

----------------------------------------------------------------------------------------><----------
-P--Q--A--I--I--I--W--D--I--L--T--G--H--K--K--R--G--F--H--C--E--S--S--A--H--W--P--I--F--K--W--S--H--
CCTCAGGCCATAATCATCTGGGACATCCTTACGGGGCACAAGAAGAGGGGTTTTCACTGTGAGAGCTCAGCCCATTGGCCTATTTTTAAGTGGAGCCATG
::::::::::: :::::::::::::::::.:: ::::: ::::::::.:: ::::::::.::::::::::::::.::::: ::::::             
CCTCAGGCCATCATCATCTGGGACATCCTCACCGGGCAGAAGAAGAGAGGGTTTCACTGCGAGAGCTCAGCCCACTGGCCGATTTTT-------------
-P--Q--A--I--I--I--W--D--I--L--T--G--Q--K--K--R--G--F--H--C--E--S--S--A--H--W--P--I--F--------------

-------------------------------------------------------><-------------------------------------------
D--G--K--F--F--A--R--M--T--L--D--T--L--S--I--Y--E--T--P--S--M--G--L--L--D--K--K--S--L--K--I--S--G--I
ATGGCAAATTCTTTGCCAGAATGACCCTGGATACGCTTAGCATCTATGAAACTCCTTCTATGGGTCTTTTGGACAAGAAGAGTTTGAAGATCTCTGGGAT
                                                        ::::::::::::.:::::::::::::.:::::::::::::: ::
--------------------------------------------------------TCTATGGGTCTTCTGGACAAGAAGAGCTTGAAGATCTCTGGCAT
---------------------------------------------------------S--M--G--L--L--D--K--K--S--L--K--I--S--G--I

--><------------------------------------------------------------------------------------------------
--K--D--F--S--W--S--P--G--G--N--I--I--A--F--W--V--P--E--D--K--D--I--P--A--R--V--T--L--M--Q--L--P--T-
AAAAGACTTTTCTTGGTCTCCTGGTGGTAACATAATCGCCTTCTGGGTGCCTGAAGACAAAGATATTCCAGCCAGGGTAACCCTGATGCAGCTCCCTACC
:   :::::::: :::::.::.:: :::::::: :::::::::::::::::.::::::::.:::::.::.::: ::::.::::::::::::::::::: :
A---GACTTTTCGTGGTCCCCCGGGGGTAACATCATCGCCTTCTGGGTGCCCGAAGACAAGGATATCCCGGCCCGGGTGACCCTGATGCAGCTCCCTAGC
-----D--F--S--W--S--P--G--G--N--I--I--A--F--W--V--P--E--D--K--D--I--P--A--R--V--T--L--M--Q--L--P--S-

----------------------------------------------------------------------------------------------------
-R--Q--E--I--R--V--R--N--L--F--N--V--V--D--C--K--L--H--W--Q--K--N--G--D--Y--L--C--V--K--V--D--R--T--
AGGCAAGAGATCCGAGTGAGGAACCTGTTCAATGTGGTGGACTGCAAGCTCCATTGGCAGAAGAACGGAGACTACTTGTGTGTGAAAGTAGATAGGACTC
:::::.:::::::: ::: : ::::: :::::.::::::::::::::::: ::.:::::::::::::: ::.:::.::::.:: ::.:: ::. :::: :
AGGCAGGAGATCCGCGTGCGCAACCTCTTCAACGTGGTGGACTGCAAGCTGCACTGGCAGAAGAACGGCGATTACCTGTGCGTCAAGGTCGACCGGACGC
-R--Q--E--I--R--V--R--N--L--F--N--V--V--D--C--K--L--H--W--Q--K--N--G--D--Y--L--C--V--K--V--D--R--T--

-------------><-----------------------------------------------------------------------><------------
P--K--G--T--Q--G--V--V--T--N--F--E--I--F--R--M--R--E--K--Q--V--P--V--D--V--V--E--M--K--E--T--I--I--A
CGAAAGGCACCCAGGGTGTTGTCACAAATTTTGAAATTTTCCGAATGAGGGAGAAACAGGTACCTGTGGATGTGGTCGAGATGAAAGAAACCATCATAGC
: ::::::::::::::::::::::::::::::::::::::::::::: ::::.::::::::.:::::::::::::::::.::::::   :::::::::::
CCAAAGGCACCCAGGGTGTTGTCACAAATTTTGAAATTTTCCGAATGCGGGAAAAACAGGTGCCTGTGGATGTGGTCGAAATGAAA---ACCATCATAGC
P--K--G--T--Q--G--V--V--T--N--F--E--I--F--R--M--R--E--K--Q--V--P--V--D--V--V--E--M--K-----T--I--I--A

----------------------------------------------------------------------------------------------------
--F--A--W--E--P--N--G--S--K--F--A--V--L--H--G--E--A--P--R--I--S--V--S--F--Y--H--V--K--N--N--G--K--I-
CTTTGCCTGGGAACCAAATGGAAGTAAGTTTGCTGTGCTGCACGGAGAGGCTCCGCGGATATCTGTGTCTTTCTACCACGTCAAAAACAACGGGAAGATT
::::::::::::.::.::.::.:::::::::::::::::::::::.:::::::: ::::::::.:::::.::::::::::: ::.:::::::: :::::.
CTTTGCCTGGGAGCCGAACGGGAGTAAGTTTGCTGTGCTGCACGGGGAGGCTCCTCGGATATCCGTGTCCTTCTACCACGTGAAGAACAACGGCAAGATC
--F--A--W--E--P--N--G--S--K--F--A--V--L--H--G--E--A--P--R--I--S--V--S--F--Y--H--V--K--N--N--G--K--I-

---------><-----------------------------------------------------------------------------><----------
-E--L--I--K--M--F--D--K--Q--Q--A--N--T--I--F--W--S--P--Q--G--Q--F--V--V--L--A--G--L--R--S--M--N--G--
GAACTCATCAAGATGTTCGACAAGCAGCAGGCGAACACCATCTTCTGGAGCCCCCAAGGACAGTTCGTGGTGTTGGCGGGCCTGAGGAGTATGAACGGTG
::.::::::   ::::::::.::::::::::: :::::::::::::::::::: ::.::::::::::: :::.:::: :: ::::::   ::::::::.:
GAGCTCATC---ATGTTCGATAAGCAGCAGGCCAACACCATCTTCTGGAGCCCGCAGGGACAGTTCGTCGTGCTGGCTGGACTGAGG---ATGAACGGCG
-E--L--I-----M--F--D--K--Q--Q--A--N--T--I--F--W--S--P--Q--G--Q--F--V--V--L--A--G--L--R-----M--N--G--

----------------------------------------------------------------------------------------------------
A--L--A--F--V--D--T--S--D--C--T--V--M--N--I--A--E--H--Y--M--A--S--D--V--E--W--D--P--T--G--R--Y--V--V
CCTTAGCGTTTGTGGACACTTCGGACTGCACGGTCATGAACATCGCAGAGCACTACATGGCTTCCGACGTCGAATGGGATCCTACTGGGCGCTACGTCGT
::::.:::::.:: ::::::::.:::::.:::::::::::.::::::::::::::::::::.:::::::: ::.:::::.::::: :::::.::::::::
CCTTGGCGTTCGTCGACACTTCAGACTGTACGGTCATGAATATCGCAGAGCACTACATGGCCTCCGACGTGGAGTGGGACCCTACGGGGCGTTACGTCGT
A--L--A--F--V--D--T--S--D--C--T--V--M--N--I--A--E--H--Y--M--A--S--D--V--E--W--D--P--T--G--R--Y--V--V

---------------------------><-----------------------------------------------------------------------
--T--S--V--S--W--W--S--H--K--V--D--N--A--Y--W--L-----W--T--F--Q--G--R-----L--L--Q--K--N--N--K--D--R-
CACCTCTGTGTCCTGGTGGAGCCATAAGGTGGACAACGCGTACTGGCTG---TGGACTTTCCAGGGACGC---CTCCTGCAGAAGAACAACAAGGACCGC
::::::.:::::::::::::::::.::::: :::::.:: :::::::::     :::.:::::.:: ::    ::::::::::::::::.::::::::::
CACCTCCGTGTCCTGGTGGAGCCACAAGGTTGACAATGCTTACTGGCTGT--GTGACCTTCCAAGGCCGGG--CTCCTGCAGAAGAACAGCAAGGACCGC
--T--S--V--S--W--W--S--H--K--V--D--N--A--Y--W--L--\--W--T--F--Q--G--R--\--L--L--Q--K--N--S--K--D--R-

-----------------------------------------------------------><---------------------------------------
-F--C--Q--L--L--W--R--P--R--P--P--T--L--L--S--Q--E--Q--I--K--Q--I--K--K--D--L--K--K--Y--S--K--I--F--
TTCTGCCAGCTGCTGTGGCGGCCCCGGCCTCCCACACTCCTGAGCCAGGAACAGATCAAGCAAATTAAAAAGGATCTGAAGAAATACTCTAAGATCTTTG
::.::::::::::::::::::::.:::::.:::::.:::::::::::::: ::::::::::::::::::::::::::::::::::::::.::::::::::
TTTTGCCAGCTGCTGTGGCGGCCTCGGCCCCCCACGCTCCTGAGCCAGGATCAGATCAAGCAAATTAAAAAGGATCTGAAGAAATACTCCAAGATCTTTG
-F--C--Q--L--L--W--R--P--R--P--P--T--L--L--S--Q--D--Q--I--K--Q--I--K--K--D--L--K--K--Y--S--K--I--F--

-------------------------------------><-------------------------------------------------------------
E--Q--K--D--R--L--S--Q--S--K--A--S--K--E--L--V--E--R--R--R--T--M--M--E--D--F--R--K--Y--R--K--M--A--Q
AACAGAAGGATCGTTTGAGTCAGTCCAAAGCCTCAAAGGAATTGGTGGAGAGAAGGCGCACCATGATGGAAGATTTCCGGAAGTACCGGAAAATGGCCCA
::::::::::::::.::::.::.:::::::::::::::::.::.:::::::::::. : :::::::::::::::::::::::.::.::::::: :::.::
AACAGAAGGATCGTCTGAGCCAATCCAAAGCCTCAAAGGAGTTAGTGGAGAGAAGAAGAACCATGATGGAAGATTTCCGGAAATATCGGAAAAAGGCTCA
E--Q--K--D--R--L--S--Q--S--K--A--S--K--E--L--V--E--R--R--R--T--M--M--E--D--F--R--K--Y--R--K--K--A--Q

----------------------------------------------><----------------------------------------------------
--E--L--Y--M--E--Q--K--N--E--R--L--E--L--R--G--G--V--D--T--D--E--L--D--S--N--V--D--D--W--E--E--E--T-
GGAGCTCTATATGGAGCAGAAAAACGAGCGCCTGGAGTTGCGAGGAGGGGTGGACACTGACGAGCTGGACAGCAACGTGGACGACTGGGAAGAGGAGACC
.::.:::::.::::::::::::::::::::.::.::.:::::::::   :::::::: :::::::::::::::::.::::::::::::::.:::::::::
AGAACTCTACATGGAGCAGAAAAACGAGCGTCTAGAATTGCGAGGA---GTGGACACGGACGAGCTGGACAGCAATGTGGACGACTGGGAGGAGGAGACC
--E--L--Y--M--E--Q--K--N--E--R--L--E--L--R--G-----V--D--T--D--E--L--D--S--N--V--D--D--W--E--E--E--T-

-------------------------------------------------->
-I--E--F--F--V--T--E--E--I--I--P--L--G--N--Q--E--*-
ATTGAGTTCTTCGTCACTGAAGAAATCATTCCCCTCGGGAATCAGGAGTGA
:: :::::.:::::::: ::::::::.:::::.::.:: ::::::::::::
ATAGAGTTTTTCGTCACAGAAGAAATTATTCCTCTTGGCAATCAGGAGTGA
-I--E--F--F--V--T--E--E--I--I--P--L--G--N--Q--E--*-

Pig Consensus Sequence

>BGISUST0000883913
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-TTACTGGGAGACGTACTCAAAGATCGGCCGCAGGAAGCAGACGGGATTGATTCGGTCATCGTGGTGGACAACGTCCCGCAGGTGGGACCTGACCGTCTG
GAGAAACTCAAAAACGTCATCCATAAGATCTTCTCCAAGTTTGGGAAAATCACGAACGACTTTTATCCGGAGGAGGACGGAAGGACCAAA----------
----------------------------------------------------------------------------------------------------
-------------TACATGACCATCAGCGACGAATGGGACATTCCAGAGAAGCAGCCTTTCAAAGACCTGGGGAACTTACGTTACTGGCTCGAGGAGGCG
GAGTGCCGAGATCAGTACAGCGTGATTTTTGAGAGTGGAGACCGCACGTCCATATTCTGGAACGACGTCAAGGGCCCCGTGTCCATTGAAGAGAGAGCG-
--TGGACAGAGACCTACGTGCGTTGGTCCCCTAAGGGCACCTACCTGGCGACCTTTCATCAGCGAGGCATTGCTCTCTGGGGAGGAGAGAAATTCAAACA
GATCCAGAGATTCAGCCACCAAGGGGTCCAGCTCATCGACTTCTCGCCGTGTGAA---TACCTGGTGACTTTCAGCCCCCTGATGGACACTCAGGACGAC
CCTCAGGCCATCATCATCTGGGACATCCTCACCGGGCAGAAGAAGAGAGGGTTTCACTGCGAGAGCTCAGCCCACTGGCCGATTTTT-------------
--------------------------------------------------------TCTATGGGTCTTCTGGACAAGAAGAGCTTGAAGATCTCTGGCAT
A---GACTTTTCGTGGTCCCCCGGGGGTAACATCATCGCCTTCTGGGTGCCCGAAGACAAGGATATCCCGGCCCGGGTGACCCTGATGCAGCTCCCTAGC
AGGCAGGAGATCCGCGTGCGCAACCTCTTCAACGTGGTGGACTGCAAGCTGCACTGGCAGAAGAACGGCGATTACCTGTGCGTCAAGGTCGACCGGACGC
CCAAAGGCACCCAGGGTGTTGTCACAAATTTTGAAATTTTCCGAATGCGGGAAAAACAGGTGCCTGTGGATGTGGTCGAAATGAAA---ACCATCATAGC
CTTTGCCTGGGAGCCGAACGGGAGTAAGTTTGCTGTGCTGCACGGGGAGGCTCCTCGGATATCCGTGTCCTTCTACCACGTGAAGAACAACGGCAAGATC
GAGCTCATC---ATGTTCGATAAGCAGCAGGCCAACACCATCTTCTGGAGCCCGCAGGGACAGTTCGTCGTGCTGGCTGGACTGAGG---ATGAACGGCG
CCTTGGCGTTCGTCGACACTTCAGACTGTACGGTCATGAATATCGCAGAGCACTACATGGCCTCCGACGTGGAGTGGGACCCTACGGGGCGTTACGTCGT
CACCTCCGTGTCCTGGTGGAGCCACAAGGTTGACAATGCTTACTGGCTggTGACCTTCCAAGGCCGgcTCCTGCAGAAGAACAGCAAGGACCGCTTTTGC
CAGCTGCTGTGGCGGCCTCGGCCCCCCACGCTCCTGAGCCAGGATCAGATCAAGCAAATTAAAAAGGATCTGAAGAAATACTCCAAGATCTTTGAACAGA
AGGATCGTCTGAGCCAATCCAAAGCCTCAAAGGAGTTAGTGGAGAGAAGAAGAACCATGATGGAAGATTTCCGGAAATATCGGAAAAAGGCTCAAGAACT
CTACATGGAGCAGAAAAACGAGCGTCTAGAATTGCGAGGA---GTGGACACGGACGAGCTGGACAGCAATGTGGACGACTGGGAGGAGGAGACCATAGAG
TTTTTCGTCACAGAAGAAATTATTCCTCTTGGCAATCAGGAGTGA


>BGISUSP0000883913
----------------------------------------------------------------------------------------------------
-------------------------------------------------------------------LLGDVLKDRPQEADGIDSVIVVDNVPQVGPDRL
EKLKNVIHKIFSKFGKITNDFYPEEDGRTK-----------------------------------------YMTISDEWDIPEKQPFKDLGNLRYWLEEA
ECRDQYSVIFESGDRTSIFWNDVKGPVSIEERA-WTETYVRWSPKGTYLATFHQRGIALWGGEKFKQIQRFSHQGVQLIDFSPCE-YLVTFSPLMDTQDD
PQAIIIWDILTGQKKRGFHCESSAHWPIF-----------------------SMGLLDKKSLKISGI-DFSWSPGGNIIAFWVPEDKDIPARVTLMQLPS
RQEIRVRNLFNVVDCKLHWQKNGDYLCVKVDRTPKGTQGVVTNFEIFRMREKQVPVDVVEMK-TIIAFAWEPNGSKFAVLHGEAPRISVSFYHVKNNGKI
ELI-MFDKQQANTIFWSPQGQFVVLAGLR-MNGALAFVDTSDCTVMNIAEHYMASDVEWDPTGRYVVTSVSWWSHKVDNAYWLVTFQGRLLQKNSKDRFC
QLLWRPRPPTLLSQDQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKYRKKAQELYMEQKNERLELRG-VDTDELDSNVDDWEEETIE
FFVTEEIIPLGNQE*