Sequences
EST Library Info
cli1Liver - RNA from China
eje2Foetus 50 days, jejunum
pigcb2Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000137700 (click for geneview)
Transcript ID ENST00000315343(link to ensembl)
Symbol SLC37A4
Localtion Chromosome:11:118400276:118406631:-1 band: 11q23.3
Description Glucose 6-phosphate translocase (Glucose 5-phosphate transporter) (Solute carrier family 37, member 4) (PRO0685).
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--A--A--Q--G--Y--G--Y--Y--R--T--V--I--F--S--A--M--F--G--G--Y--S--L--Y--Y--F--N--R--K--T--F--S--F--
ATGGCAGCCCAGGGCTATGGCTATTATCGCACTGTGATCTTCTCAGCCATGTTTGGGGGCTACAGCCTGTATTACTTCAATCGCAAGACCTTCTCCTTTG
:::::.::::..:::::.:::::::::::..:::::::::::::::::::::::::.::::::::::::::.::::::::.:::::::::::::::::::
ATGGCGGCCCGAGGCTACGGCTATTATCGTGCTGTGATCTTCTCAGCCATGTTTGGAGGCTACAGCCTGTACTACTTCAACCGCAAGACCTTCTCCTTTG
-M--A--A--R--G--Y--G--Y--Y--R--A--V--I--F--S--A--M--F--G--G--Y--S--L--Y--Y--F--N--R--K--T--F--S--F--

-----------------------------------------------><---------------------------------------------------
V--M--P--S--L--V--E--E--I--P--L--D--K--D--D--L--G--F--I--T--S--S--Q--S--A--A--Y--A--I--S--K--F--V--S
TCATGCCATCATTGGTGGAAGAGATCCCTTTGGACAAGGATGATTTGGGGTTCATCACCAGCAGCCAGTCGGCAGCTTATGCTATCAGCAAGTTTGTCAG
:::::::.::..::::::::::::::: :.:::::::::::::.:::   .::::::::::.::::::::.:::::.:::::.:::::::::::::: ::
TCATGCCGTCGCTGGTGGAAGAGATCCGTCTGGACAAGGATGACTTG---CTCATCACCAGTAGCCAGTCAGCAGCCTATGCCATCAGCAAGTTTGTGAG
V--M--P--S--L--V--E--E--I--R--L--D--K--D--D--L-----L--I--T--S--S--Q--S--A--A--Y--A--I--S--K--F--V--S

----------------------------------------------------------------------------------------------------
--G--V--L--S--D--Q--M--S--A--R--W--L--F--S--S--G--L--L--L--V--G--L--V--N--I--F--F--A--W--S--S--T--V-
TGGGGTGCTGTCTGACCAGATGAGTGCTCGCTGGCTCTTCTCTTCTGGGCTGCTCCTGGTTGGCCTGGTCAACATATTCTTTGCCTGGAGCTCCACAGTA
::::::::::::::::::::::::::::::::::::::::::.:::::::::::.:: ::::::::::::::..:  ::::: :::::::::::::::::
TGGGGTGCTGTCTGACCAGATGAGTGCTCGCTGGCTCTTCTCCTCTGGGCTGCTTCTTGTTGGCCTGGTCAATGTCATCTTTTCCTGGAGCTCCACAGTA
--G--V--L--S--D--Q--M--S--A--R--W--L--F--S--S--G--L--L--L--V--G--L--V--N--V--I--F--S--W--S--S--T--V-

--------------------------------------------------------------------------------><------------------
-P--V--F--A--A--L--W--F--L--N--G--L--A--Q--G--L--G--W--P--P--C--G--K--V--L--R--K--W--F--E--P--S--Q--
CCTGTCTTTGCTGCCCTCTGGTTCCTTAATGGCCTGGCCCAGGGGCTGGGCTGGCCCCCATGTGGGAAGGTCCTGCGGAAGTGGTTTGAGCCATCTCAGT
::::::::.:::::.:::::::::::.::::::::::::::::::::::::::::::::.::::: :::.::.:::::::::::::::::::::::::::
CCTGTCTTCGCTGCTCTCTGGTTCCTCAATGGCCTGGCCCAGGGGCTGGGCTGGCCCCCGTGTGGCAAGATCTTGCGGAAGTGGTTTGAGCCATCTCAGT
-P--V--F--A--A--L--W--F--L--N--G--L--A--Q--G--L--G--W--P--P--C--G--K--I--L--R--K--W--F--E--P--S--Q--

----------------------------------------------------------------------------------------------------
F--G--T--W--W--A--I--L--S--T--S--M--N--L--A--G--G--L--G--P--I--L--A--T--I--L--A--Q--S--Y--S--W--R--S
TTGGCACTTGGTGGGCCATCCTGTCAACCAGCATGAACCTGGCTGGAGGGCTGGGCCCTATCCTGGCAACCATCCTTGCCCAGAGCTACAGCTGGCGCAG
::::::::::::::::::::::.:::::.:::::::::::::::::::::::::::::.:::::::::::::::::.:::::::::::.::::::::.::
TTGGCACTTGGTGGGCCATCCTATCAACTAGCATGAACCTGGCTGGAGGGCTGGGCCCCATCCTGGCAACCATCCTCGCCCAGAGCTATAGCTGGCGTAG
F--G--T--W--W--A--I--L--S--T--S--M--N--L--A--G--G--L--G--P--I--L--A--T--I--L--A--Q--S--Y--S--W--R--S

------------------------><--------------------------------------------------------------------------
--T--L--A--L--S--G--A--L--V--V--V--S--F--L--C--L--L--L--I--H--N--E--P--A--D--V--G--L--R--N--L--D--P-
CACGCTGGCCCTATCTGGGGCACTGGTGGTTGTCTCCTTCCTCTGTCTCCTGCTCATCCACAATGAACCTGCTGATGTTGGACTCCGCAACCTGGACCCC
::::::::::::.:::::::: .::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.
CACGCTGGCCCTGTCTGGGGCCTTGGTGGTTGTCTCCTTCCTCTGTCTCCTGCTCATCCACAATGAACCTGCTGATGTTGGACTCCGCAACCTGGACCCT
--T--L--A--L--S--G--A--L--V--V--V--S--F--L--C--L--L--L--I--H--N--E--P--A--D--V--G--L--R--N--L--D--P-

---------------------><-----------------------------------------------------------------------------
-M--P--S--E--G--K--K--G--S--L--K--E--E--S--T--L--Q--E--L--L--L--S--P--Y--L--W--V--L--S--T--G--Y--L--
ATGCCCTCTGAGGGCAAGAAGGGCTCCTTGAAGGAGGAGAGCACCCTGCAGGAGCTGCTGCTGTCCCCTTACCTGTGGGTGCTCTCCACTGGTTACCTTG
:: :::::..:::::::::::   ::::..:::::::::::.:::.:.::::::::::::::: ::::.:::::::::::::::::::.:::.:::::::
ATCCCCTCCAAGGGCAAGAAG---TCCTCAAAGGAGGAGAGTACCTTACAGGAGCTGCTGCTGACCCCCTACCTGTGGGTGCTCTCCATTGGCTACCTTG
-I--P--S--K--G--K--K-----S--S--K--E--E--S--T--L--Q--E--L--L--L--T--P--Y--L--W--V--L--S--I--G--Y--L--

--------------------------------------------------------------------------------><------------------
V--V--F--G--V--K--T--C--C--T--D--W--G--Q--F--F--L--I--Q--E--K--G--Q--S--A--L--V--G--S--S--Y--M--S--A
TGGTGTTTGGAGTAAAGACCTGCTGTACTGACTGGGGCCAGTTCTTCCTTATCCAGGAGAAAGGACAGTCAGCCCTTGTAGGTAGCTCCTACATGAGTGC
::::.::::: :::::::: ::::::::::::::::::::::::::::::::::::::::::::::::::::::::.      :::::::::::::::::
TGGTATTTGGCGTAAAGACGTGCTGTACTGACTGGGGCCAGTTCTTCCTTATCCAGGAGAAAGGACAGTCAGCCCTC------AGCTCCTACATGAGTGC
V--V--F--G--V--K--T--C--C--T--D--W--G--Q--F--F--L--I--Q--E--K--G--Q--S--A--L--------S--S--Y--M--S--A

------------------------------------------------------------------><--------------------------------
--L--E--V--G--G--L--V--G--S--I--A--A--G--Y--L--S--D--R--A--M--A--K--A--G--L--S--N--Y--G--N--P--R--H-
CCTGGAAGTTGGGGGCCTTGTAGGCAGCATCGCAGCTGGCTACCTGTCAGACCGGGCCATGGCAAAGGCGGGACTGTCCAACTACGGGAACCCTCGCCAT
::::::.::::::::::::::::::::::::::::::::::::.:::::::::::::::::::::::::.::.::::::: :.::::::::::.::::::
CCTGGAGGTTGGGGGCCTTGTAGGCAGCATCGCAGCTGGCTACTTGTCAGACCGGGCCATGGCAAAGGCAGGGCTGTCCATCCACGGGAACCCCCGCCAT
--L--E--V--G--G--L--V--G--S--I--A--A--G--Y--L--S--D--R--A--M--A--K--A--G--L--S--I--H--G--N--P--R--H-

--------------------------------------------------------------------------------><------------------
-G--L--L--L--F--M--M--A--G--M--T--V--S--M--Y--L--F--R--V--T--V--T--S--D--S--P--K--L--W--I--L--V--L--
GGCCTGTTGCTGTTCATGATGGCTGGCATGACAGTGTCCATGTACCTCTTCCGGGTAACAGTGACCAGTGACTCCCCCAAGCTCTGGATCCTGGTATTGG
::::::.:::::.:::::::::::::::::::::..::::::::::::::::::::::: :::::::::::::::::.:::::::::::::::::.::::
GGCCTGCTGCTGCTCATGATGGCTGGCATGACAGCATCCATGTACCTCTTCCGGGTAACTGTGACCAGTGACTCCCCTAAGCTCTGGATCCTGGTGTTGG
-G--L--L--L--L--M--M--A--G--M--T--A--S--M--Y--L--F--R--V--T--V--T--S--D--S--P--K--L--W--I--L--V--L--

----------------------------------------------------------------------------------------------------
G--A--V--F--G--F--S--S--Y--G--P--I--A--L--F--G--V--I--A--N--E--S--A--P--P--N--L--C--G--T--S--H--A--I
GAGCTGTATTTGGTTTCTCCTCGTATGGCCCCATTGCCCTGTTTGGAGTCATAGCCAACGAGAGTGCCCCTCCCAACTTGTGTGGCACCTCCCACGCCAT
:::::::.:::::::::::::: :::::.:::::::::.:::::::::::::::::::.::::::::::::::::::.::::::::::::::::.:::::
GAGCTGTGTTTGGTTTCTCCTCTTATGGTCCCATTGCCTTGTTTGGAGTCATAGCCAATGAGAGTGCCCCTCCCAACCTGTGTGGCACCTCCCATGCCAT
G--A--V--F--G--F--S--S--Y--G--P--I--A--L--F--G--V--I--A--N--E--S--A--P--P--N--L--C--G--T--S--H--A--I

-------------------><-------------------------------------------------------------------------------
--V--G--L--M--A--N--V--G--G--F--L--A--G--L--P--F--S--T--I--A--K--H--Y--S--W--S--T--A--F--W--V--A--E-
TGTGGGACTCATGGCCAATGTGGGCGGCTTTCTGGCTGGGCTGCCCTTCAGCACCATTGCCAAGCACTACAGTTGGAGCACAGCCTTCTGGGTGGCTGAA
:::::::::::::::::::   ::.:::::::::::::::.:::::::::::::::::::::::::.:::::.:::::::::::::::::::::::::::
TGTGGGACTCATGGCCAAT---GGTGGCTTTCTGGCTGGGTTGCCCTTCAGCACCATTGCCAAGCATTACAGCTGGAGCACAGCCTTCTGGGTGGCTGAA
--V--G--L--M--A--N-----G--G--F--L--A--G--L--P--F--S--T--I--A--K--H--Y--S--W--S--T--A--F--W--V--A--E-

-------------------------------------------------------------------------------------->
-V--I--C--A--A--S--T--A--A--F--F--L--L--R--N--I--R--T--K--M--G--R--V--S--K--K--A--E--*-
GTGATTTGTGCGGCCAGCACGGCTGCCTTCTTCCTCCTACGAAACATCCGCACCAAGATGGGCCGAGTGTCCAAGAAGGCTGAGTGA
:::::.:::::::::::.::.: ::::::::::::::::::::::::::::::::::::::::::::::.: :::::::::::::::
GTGATCTGTGCGGCCAGTACAGGTGCCTTCTTCCTCCTACGAAACATCCGCACCAAGATGGGCCGAGTGCCAAAGAAGGCTGAGTGA
-V--I--C--A--A--S--T--G--A--F--F--L--L--R--N--I--R--T--K--M--G--R--V--P--K--K--A--E--*-

Pig Consensus Sequence

>BGISUST0000881391
ATGGCGGCCCGAGGCTACGGCTATTATCGTGCTGTGATCTTCTCAGCCATGTTTGGAGGCTACAGCCTGTACTACTTCAACCGCAAGACCTTCTCCTTTG
TCATGCCGTCGCTGGTGGAAGAGATCCGTCTGGACAAGGATGACTTG---CTCATCACCAGTAGCCAGTCAGCAGCCTATGCCATCAGCAAGTTTGTGAG
TGGGGTGCTGTCTGACCAGATGAGTGCTCGCTGGCTCTTCTCCTCTGGGCTGCTTCTTGTTGGCCTGGTCAATGTCATCTTTTCCTGGAGCTCCACAGTA
CCTGTCTTCGCTGCTCTCTGGTTCCTCAATGGCCTGGCCCAGGGGCTGGGCTGGCCCCCGTGTGGCAAGATCTTGCGGAAGTGGTTTGAGCCATCTCAGT
TTGGCACTTGGTGGGCCATCCTATCAACTAGCATGAACCTGGCTGGAGGGCTGGGCCCCATCCTGGCAACCATCCTCGCCCAGAGCTATAGCTGGCGTAG
CACGCTGGCCCTGTCTGGGGCCTTGGTGGTTGTCTCCTTCCTCTGTCTCCTGCTCATCCACAATGAACCTGCTGATGTTGGACTCCGCAACCTGGACCCT
ATCCCCTCCAAGGGCAAGAAG---TCCTCAAAGGAGGAGAGTACCTTACAGGAGCTGCTGCTGACCCCCTACCTGTGGGTGCTCTCCATTGGCTACCTTG
TGGTATTTGGCGTAAAGACGTGCTGTACTGACTGGGGCCAGTTCTTCCTTATCCAGGAGAAAGGACAGTCAGCCCTC------AGCTCCTACATGAGTGC
CCTGGAGGTTGGGGGCCTTGTAGGCAGCATCGCAGCTGGCTACTTGTCAGACCGGGCCATGGCAAAGGCAGGGCTGTCCATCCACGGGAACCCCCGCCAT
GGCCTGCTGCTGCTCATGATGGCTGGCATGACAGCATCCATGTACCTCTTCCGGGTAACTGTGACCAGTGACTCCCCTAAGCTCTGGATCCTGGTGTTGG
GAGCTGTGTTTGGTTTCTCCTCTTATGGTCCCATTGCCTTGTTTGGAGTCATAGCCAATGAGAGTGCCCCTCCCAACCTGTGTGGCACCTCCCATGCCAT
TGTGGGACTCATGGCCAAT---GGTGGCTTTCTGGCTGGGTTGCCCTTCAGCACCATTGCCAAGCATTACAGCTGGAGCACAGCCTTCTGGGTGGCTGAA
GTGATCTGTGCGGCCAGTACAGGTGCCTTCTTCCTCCTACGAAACATCCGCACCAAGATGGGCCGAGTGCCAAAGAAGGCTGAGTGA


>BGISUSP0000881391
MAARGYGYYRAVIFSAMFGGYSLYYFNRKTFSFVMPSLVEEIRLDKDDL-LITSSQSAAYAISKFVSGVLSDQMSARWLFSSGLLLVGLVNVIFSWSSTV
PVFAALWFLNGLAQGLGWPPCGKILRKWFEPSQFGTWWAILSTSMNLAGGLGPILATILAQSYSWRSTLALSGALVVVSFLCLLLIHNEPADVGLRNLDP
IPSKGKK-SSKEESTLQELLLTPYLWVLSIGYLVVFGVKTCCTDWGQFFLIQEKGQSAL--SSYMSALEVGGLVGSIAAGYLSDRAMAKAGLSIHGNPRH
GLLLLMMAGMTASMYLFRVTVTSDSPKLWILVLGAVFGFSSYGPIALFGVIANESAPPNLCGTSHAIVGLMAN-GGFLAGLPFSTIAKHYSWSTAFWVAE
VICAASTGAFFLLRNIRTKMGRVPKKAE*