Sequences
EST Library Info
cbl1Blood
cov1Ovary - RNA from China
eje2Foetus 50 days, jejunum
ese1Foetus 50 days, M. semitendinosus
fat1Fatt
pigcb3Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000135506 (click for geneview)
Transcript ID ENST00000315970(link to ensembl)
Symbol OS9_HUMAN
Localtion Chromosome:12:56374171:56401605:1 band: 12q14.1
Description Protein OS-9 precursor.
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--A--A--E--T--L--L--S--S--L--L--G--L--L--L--L--G--L-----L--L--P--A--S--L--T--G--G--V--G--S--L--N--
ATGGCGGCGGAAACGCTGCTGTCCAGTTTGTTAGGACTGCTGCTTCTGGGACTC---CTGTTACCCGCAAGTCTGACCGGCGGTGTCGGGAGCCTGAACC
:::::::::::.:::::::::::::::.::::.::.::.:::::::::::.:::   :::::::::::::.:::::::::::::::::::::::::::::
ATGGCGGCGGAGACGCTGCTGTCCAGTCTGTTGGGGCTACTGCTTCTGGGGCTCC--CTGTTACCCGCAAATCTGACCGGCGGTGTCGGGAGCCTGAACC
-M--A--A--E--T--L--L--S--S--L--L--G--L--L--L--L--G--L--\--L--L--P--A--N--L--T--G--G--V--G--S--L--N--

-------------------------------------------------------------------><-------------------------------
L--E--E--L--S--E--M--R--Y--G--I--E--I--L--P-----L--P--V--M--G--G--Q--S--Q--S--S--D--V--V--I--V--S--S
TGGAGGAGCTGAGTGAGATGCGTTATGGGATCGAGATCCTGCCG---TTGCCTGTCATGGGAGGGCAGAGCCAATCTTCGGACGTGGTGATTGTCTCCTC
::::.:::::::::::::::::::::::::::::.:: :::::    ::::::::::::::::::::::.:::: :::::::::::::::::::::::::
TGGAAGAGCTGAGTGAGATGCGTTATGGGATCGAAATACTGCCCG--TTGCCTGTCATGGGAGGGCAGAACCAAGCTTCGGACGTGGTGATTGTCTCCTC
L--E--E--L--S--E--M--R--Y--G--I--E--I--L--P--\--L--P--V--M--G--G--Q--N--Q--A--S--D--V--V--I--V--S--S

----------------------------------------------------------------------------------------------------
--K--Y--K--Q--R--Y--E--C--R--L--P--A--G--A--I--H--F--Q--R--E--R--E--E--E--T--P--A--Y--Q--G--P--G--I-
TAAGTACAAACAGCGCTATGAGTGTCGCCTGCCAGCTGGAGCTATTCACTTCCAGCGTGAAAGGGAGGAGGAAACACCTGCTTACCAAGGGCCTGGGATC
:::::::::.:::::::::::.:::::::: :::::::::::::::::::::::::::::::::::::::::..::::::::::.:::::::::::::::
TAAGTACAAGCAGCGCTATGAATGTCGCCTTCCAGCTGGAGCTATTCACTTCCAGCGTGAAAGGGAGGAGGAGGCACCTGCTTATCAAGGGCCTGGGATC
--K--Y--K--Q--R--Y--E--C--R--L--P--A--G--A--I--H--F--Q--R--E--R--E--E--E--A--P--A--Y--Q--G--P--G--I-

--------------------------------------------><------------------------------------------------------
-P--E--L--L--S--P--M--R--D--A--P--C--L--L--K--T--K--D--W--W--T--Y--E--F--C--Y--G--R--H--I--Q--Q--Y--
CCTGAGTTGTTGAGCCCAATGAGAGATGCTCCCTGCTTGCTGAAGACAAAGGACTGGTGGACATATGAATTCTGTTATGGACGCCACATCCAGCAATACC
::::::::::::::::::::::.:::::::::::::.:::::::::: ::.:::::::::::.::::::::.:::::::::::::::::::::::.::::
CCTGAGTTGTTGAGCCCAATGAAAGATGCTCCCTGCCTGCTGAAGACCAAAGACTGGTGGACGTATGAATTTTGTTATGGACGCCACATCCAGCAGTACC
-P--E--L--L--S--P--M--K--D--A--P--C--L--L--K--T--K--D--W--W--T--Y--E--F--C--Y--G--R--H--I--Q--Q--Y--

--------><---------------------------------------------------------------------------><-------------
H--M--E--D--S--E--I--K--G--E--V--L--Y--L--G--Y--Y--Q--S--A--F--D--W--D--D--E--T--A--K--A--S--K--Q--H
ACATGGAAGATTCAGAGATCAAAGGTGAAGTCCTCTATCTCGGCTACTACCAATCAGCCTTCGACTGGGATGATGAAACAGCCAAGGCCTCCAAGCAGCA
::::::::   :::::::::::::::::::::::::::::.::::::::::::::.::::::::::::::::::::::::::.:::::::::::::::::
ACATGGAA---TCAGAGATCAAAGGTGAAGTCCTCTATCTTGGCTACTACCAATCGGCCTTCGACTGGGATGATGAAACAGCTAAGGCCTCCAAGCAGCA
H--M--E-----S--E--I--K--G--E--V--L--Y--L--G--Y--Y--Q--S--A--F--D--W--D--D--E--T--A--K--A--S--K--Q--H

------------------------------------------------------------------------------------><--------------
--R--L--K--R--Y--H--S--Q--T--Y--G--N--G--S--K--C--D--L--N--G--R--P--R--E--A--E--V--R--F--L--C--D--E-
TCGTCTTAAACGCTACCACAGCCAGACCTATGGCAATGGGTCCAAGTGCGACCTTAATGGGAGGCCCCGGGAGGCCGAGGTTCGGTTCCTCTGTGACGAG
:::.:: ::::::::::::::::::::.::::::::::::::.:::::::::::.::.::::::::::::::.::.::::::::::::::::::::::::
TCGCCTGAAACGCTACCACAGCCAGACTTATGGCAATGGGTCTAAGTGCGACCTCAACGGGAGGCCCCGGGAAGCTGAGGTTCGGTTCCTCTGTGACGAG
--R--L--K--R--Y--H--S--Q--T--Y--G--N--G--S--K--C--D--L--N--G--R--P--R--E--A--E--V--R--F--L--C--D--E-

----------------------------------------------------------------------------------------------------
-G--A--G--I--S--G--D--Y--I--D--R--V--D--E--P--L--S--C--S--Y--V--L--T--I--R--T--P--R--L--C--P--H--P--
GGTGCAGGTATCTCTGGGGACTACATCGATCGCGTGGACGAGCCCTTGTCCTGCTCTTATGTGCTGACCATTCGCACTCCTCGGCTCTGCCCCCACCCTC
::::: :::::.::::: ::::::::.::.::.:::::.::::::::::::::::::::.:::::::::::::: :::.:::::::::::::.:::::::
GGTGCTGGTATTTCTGGTGACTACATTGACCGTGTGGATGAGCCCTTGTCCTGCTCTTACGTGCTGACCATTCGGACTTCTCGGCTCTGCCCTCACCCTC
-G--A--G--I--S--G--D--Y--I--D--R--V--D--E--P--L--S--C--S--Y--V--L--T--I--R--T--S--R--L--C--P--H--P--

-----------------------------------------------------------------------------------------------><---
L--L--R--P--P--P--S--A--A--P--Q--A--I--L--C--H--P--S--L--Q--P--E--E--Y--M--A--Y--V--Q--R--Q--A--D--S
TCCTCCGGCCCCCACCCAGTGCTGCACCGCAGGCCATCCTCTGTCACCCTTCCCTACAGCCTGAGGAGTACATGGCCTACGTTCAGAGGCAAGCCGACTC
::::::::::::::::::::.:::: :: ::::::::.:::::::::::: ::::.::::::::::::::::::::::::.:.:::::::::        
TCCTCCGGCCCCCACCCAGTACTGCTCCCCAGGCCATTCTCTGTCACCCTGCCCTGCAGCCTGAGGAGTACATGGCCTACATCCAGAGGCAA--------
L--L--R--P--P--P--S--T--A--P--Q--A--I--L--C--H--P--A--L--Q--P--E--E--Y--M--A--Y--I--Q--R--Q---------

-------------------------------------------------------------------------------------------------><-
--K--Q--Y--G--D--K--I--I--E--E--L--Q--D--L--G--P--Q--V--W--S--E--T--K--S--G--V--A--P--Q--K--M--A--G-
AAAGCAGTATGGAGATAAAATCATAGAGGAGCTGCAAGATCTAGGCCCCCAAGTGTGGAGTGAGACCAAGTCTGGGGTGGCACCCCAAAAGATGGCAGGT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------------------------------------------------------------------------------------><
-A--S--P--T--K--D--D--S--K--D--S--D--F--W--K--M--L--N--E--P--E--D--Q--A--P--G--G--E--E--V--P--A--E--
GCGAGCCCGACCAAGGATGACAGTAAGGACTCAGATTTCTGGAAGATGCTTAATGAGCCAGAGGACCAGGCCCCAGGAGGGGAGGAGGTGCCGGCTGAGG
::.:::::..::::::: ::::::::::: ::::::::::::::::::::: ::::::::::.:: ::::::::::.:::::::::::.:: ::::::: 
GCAAGCCCAGCCAAGGAGGACAGTAAGGAATCAGATTTCTGGAAGATGCTTCATGAGCCAGAAGAACAGGCCCCAGAAGGGGAGGAGGCGCAGGCTGAG-
-A--S--P--A--K--E--D--S--K--E--S--D--F--W--K--M--L--H--E--P--E--E--Q--A--P--E--G--E--E--A--Q--A--E--

--------------------------------------------------><------------------------------------------------
E--Q--D--P--S--P--E--A--A--D--S--A--S--G--A--P--N--D--F--Q--N--N--V--Q--V--K--V--I--R--S--P--A--D--L
AGCAGGACCCAAGCCCTGAGGCAGCAGATTCAGCTTCTGGTGCTCCCAATGATTTTCAGAACAACGTGCAGGTCAAAGTCATTCGAAGCCCTGCGGATTT
                                                     :::::::::::.::::::::::::::::::::.::.::.::.::.::
-----------------------------------------------------TTTCAGAACAATGTGCAGGTCAAAGTCATTCGGAGTCCCGCAGACTT
------------------------------------------------------F--Q--N--N--V--Q--V--K--V--I--R--S--P--A--D--L

---------------------------------------><-----------------------------------------------------------
--I--R--F--I--E--E--L--K--G--G--T--K--K--G--K--P--N--I--G--Q--E--Q--P--V--D--D--A--A--E--V--P--Q--R-
GATTCGATTCATAGAGGAGCTGAAAGGTGGAACAAAAAAGGGGAAGCCAAATATAGGCCAAGAGCAGCCTGTGGATGATGCTGCAGAAGTCCCTCAGAGG
:::::..:: ::::::::::::::.::::::::::.:::::::::::::.::..:::::::::::::::::..::.:.:::..::::::.:::::  :::
GATTCAGTTGATAGAGGAGCTGAAGGGTGGAACAAGAAAGGGGAAGCCAGATGCAGGCCAAGAGCAGCCTGCAGACGGTGCCACAGAAGCCCCTCCCAGG
--I--Q--L--I--E--E--L--K--G--G--T--R--K--G--K--P--D--A--G--Q--E--Q--P--A--D--G--A--T--E--A--P--P--R-

----------------------------------------------------------------------------------------------------
-E--P--E-----K--E--R--G--D--P--E--R--Q--R--E--M--E--E--E--E--D--E--D--E--D--E--D--E--D--E--D--E--R--
GAACCAGAG---AAGGAAAGGGGTGATCCAGAACGGCAGAGAGAGATGGAAGAAGAGGAGGATGAGGATGAGGATGAGGATGAAGATGAGGATGAACGGC
:::::::::   :::::::.:.::::.:::::::. ::::. :::.::   :::::::::::.:: :::::::::::.::.   ::::::::::::::::
GAACCAGAGGTGAAGGAAAAGAGTGACCCAGAACATCAGAACGAGGTG---GAAGAGGAGGACGACGATGAGGATGAAGAC---GATGAGGATGAACGGC
-E--P--E--V--K--E--K--S--D--P--E--H--Q--N--E--V-----E--E--E--D--D--D--E--D--E--D-----D--E--D--E--R--

----------------------------------------------------------------------------------------------------
Q--L--L--G--E--F--E--K--E--L--E--G--I--L--L--P--S--D--R--D--R--L--R--S--E--V--K--A--G--M--E--R--E--L
AGTTACTGGGAGAATTTGAGAAGGAACTGGAAGGGATCCTGCTTCCGTCAGACCGAGACCGGCTCCGTTCGGAGGTGAAGGCTGGCATGGAGCGGGAACT
::::.:::::.:::::::::::::::::::::::::: :::::.::.::::::::::::::::: ::: : ::::::::::::::::::::::::::.::
AGTTGCTGGGGGAATTTGAGAAGGAACTGGAAGGGATACTGCTCCCATCAGACCGAGACCGGCTGCGTGCCGAGGTGAAGGCTGGCATGGAGCGGGAGCT
Q--L--L--G--E--F--E--K--E--L--E--G--I--L--L--P--S--D--R--D--R--L--R--A--E--V--K--A--G--M--E--R--E--L

---------------------------------------><-----------------------------------------------------------
--E--N--I--I--Q--E--A--S--P--A--L--P--P--L--D--P--D--G--L--K--K--E--S--E--R--D--R--A--M--L--A--L--T-
GGAAAACATCATCCAGGAGGCAAGCCCAGCTCTTCCTCCTCTGGACCCAGATGGGCTGAAGAAGGAGTCAGAGCGGGATCGGGCAATGCTGGCTCTCACA
:::.:::::::::::::::                     :::::::::::::::::::::::::::::.::::: :::::::: ::.:::::..: :::
GGAGAACATCATCCAGGAG---------------------CTGGACCCAGATGGGCTGAAGAAGGAGTCGGAGCGTGATCGGGCTATACTGGCCTTGACA
--E--N--I--I--Q--E-----------------------L--D--P--D--G--L--K--K--E--S--E--R--D--R--A--I--L--A--L--T-

----------------------------------------------------------------------------------------------------
-S--T--L--N--K--L--I--K--R--L--E--E--K--Q--S--P--E--L--V--K--K--H--K--K--K--R--V--V--P--K--K--P--P--
TCCACTCTCAACAAACTCATCAAAAGACTGGAGGAAAAACAGAGTCCAGAGCTGGTGAAGAAGCACAAGAAAAAGAGGGTTGTCCCCAAAAAGCCTCCCC
:::::::::.::::::::::::::::.::.:::::::::::::.:::::::::: ::::::::::: .:::::.:::::::.::::: ::::::::::::
TCCACTCTCGACAAACTCATCAAAAGGCTAGAGGAAAAACAGAATCCAGAGCTGTTGAAGAAGCACCGGAAAAGGAGGGTTATCCCCCAAAAGCCTCCCC
-S--T--L--D--K--L--I--K--R--L--E--E--K--Q--N--P--E--L--L--K--K--H--R--K--R--R--V--I--P--Q--K--P--P--

-----------------><---------------------------------------------------------------------------------
P--S--P--Q--P--T--E--E--D--P--E--H--R--V--R--V--R--V--T--K--L--R--L--G--G--P--N--Q--D--L--T--V--L--E
CATCACCCCAACCTACAGAGGAGGATCCTGAGCACAGAGTCCGGGTCCGGGTCACCAAGCTCCGTCTCGGAGGCCCTAATCAGGATCTGACTGTCCTCGA
:.:: :::::.         :::::::. ::.::::::::::.:::::::.:::.::::::::::: :::::::::.::::.:::::::::::::::: :
CGTCTCCCCAG---------GAGGATCT-GAACACAGAGTCCAGGTCCGGATCATCAAGCTCCGTCACGGAGGCCCCAATCGGGATCTGACTGTCCTCCA
P--S--P--Q-----------E--D--P--E--H--R--V--Q--V--R--I--I--K--L--R--H--G--G--P--N--R--D--L--T--V--L--Q

-------------------------------------------------------------------------------------><-------------
--M--K--R--E--N--P--Q--L--K--Q--I--E--G--L--V--K--E--L--L--E--R--E--G--L--T--A--A--G--K--I--E--I--K-
GATGAAACGGGAAAACCCACAGCTGAAACAAATCGAGGGGCTGGTGAAGGAGCTGCTGGAGAGGGAGGGACTCACAGCTGCAGGGAAAATTGAGATCAAA
:::::::: .::::::::::::::::::::::::::::::::::::::.::::::::::::::::::::::::::::::      :::::::::::::::
GATGAAACCAGAAAACCCACAGCTGAAACAAATCGAGGGGCTGGTGAAAGAGCTGCTGGAGAGGGAGGGACTCACAGCT------AAAATTGAGATCAAA
--M--K--P--E--N--P--Q--L--K--Q--I--E--G--L--V--K--E--L--L--E--R--E--G--L--T--A--------K--I--E--I--K-

--------------------------------------------------------------------------------------------------><
-I--V--R--P--W--A--E--G--T--E--E--G--A--R--W--L--T--D--E--D--T--R--N--L--K--E--I--F--F--N--I--L--V--
ATTGTCCGCCCATGGGCTGAAGGGACTGAAGAGGGTGCACGTTGGCTGACTGATGAGGACACGAGAAACCTCAAGGAGATCTTCTTCAATATCTTGGTGC
:::::::. ::: ::.: ::::::::::::::::.:::::::::::::::::::::::::::::.: :::::::::::::.:::::::::::::::::::
ATTGTCCAACCAGGGACGGAAGGGACTGAAGAGGATGCACGTTGGCTGACTGATGAGGACACGAAACACCTCAAGGAGATTTTCTTCAATATCTTGGTGC
-I--V--Q--P--G--T--E--G--T--E--E--D--A--R--W--L--T--D--E--D--T--K--H--L--K--E--I--F--F--N--I--L--V--

----------------------------------------------------------------------------------------------------
P--G--A--E--E--A--Q--K--E--R--Q--R--Q--K--E--L--E--S--N--Y--R--R--V--W--G--S--P--G--G--E--G--T--G--D
CGGGAGCTGAAGAGGCCCAGAAGGAACGCCAGCGGCAGAAAGAGCTGGAGAGCAATTACCGCCGGGTGTGGGGCTCTCCAGGTGGGGAGGGCACAGGGGA
 ::::::::::::::. :::::.::.:: :::::::::::..::::::::::::::::::::::::::::::::::.:  :..:::::::::::.:::::
AGGGAGCTGAAGAGGTGCAGAAAGAGCGGCAGCGGCAGAAGAAGCTGGAGAGCAATTACCGCCGGGTGTGGGGCTCCCGCGACGGGGAGGGCACGGGGGA
Q--G--A--E--E--V--Q--K--E--R--Q--R--Q--K--K--L--E--S--N--Y--R--R--V--W--G--S--R--D--G--E--G--T--G--D

----------------------
--L--D--E--F--D--F--*-
CCTGGACGAATTTGACTTCTGA
::::::::::::::::::::::
CCTGGACGAATTTGACTTCTGA
--L--D--E--F--D--F--*-

Pig Consensus Sequence

>BGISUST0000895200
ATGGCGGCGGAGACGCTGCTGTCCAGTCTGTTGGGGCTACTGCTTCTGGGGCTccTGTTACCCGCAAATCTGACCGGCGGTGTCGGGAGCCTGAACCTGG
AAGAGCTGAGTGAGATGCGTTATGGGATCGAAATACTGCCctTGCCTGTCATGGGAGGGCAGAACCAAGCTTCGGACGTGGTGATTGTCTCCTCTAAGTA
CAAGCAGCGCTATGAATGTCGCCTTCCAGCTGGAGCTATTCACTTCCAGCGTGAAAGGGAGGAGGAGGCACCTGCTTATCAAGGGCCTGGGATCCCTGAG
TTGTTGAGCCCAATGAAAGATGCTCCCTGCCTGCTGAAGACCAAAGACTGGTGGACGTATGAATTTTGTTATGGACGCCACATCCAGCAGTACCACATGG
AA---TCAGAGATCAAAGGTGAAGTCCTCTATCTTGGCTACTACCAATCGGCCTTCGACTGGGATGATGAAACAGCTAAGGCCTCCAAGCAGCATCGCCT
GAAACGCTACCACAGCCAGACTTATGGCAATGGGTCTAAGTGCGACCTCAACGGGAGGCCCCGGGAAGCTGAGGTTCGGTTCCTCTGTGACGAGGGTGCT
GGTATTTCTGGTGACTACATTGACCGTGTGGATGAGCCCTTGTCCTGCTCTTACGTGCTGACCATTCGGACTTCTCGGCTCTGCCCTCACCCTCTCCTCC
GGCCCCCACCCAGTACTGCTCCCCAGGCCATTCTCTGTCACCCTGCCCTGCAGCCTGAGGAGTACATGGCCTACATCCAGAGGCAA--------------
----------------------------------------------------------------------------------------------GCAAGC
CCAGCCAAGGAGGACAGTAAGGAATCAGATTTCTGGAAGATGCTTCATGAGCCAGAAGAACAGGCCCCAGAAGGGGAGGAGGCGCAGGCTGAG-------
-----------------------------------------------TTTCAGAACAATGTGCAGGTCAAAGTCATTCGGAGTCCCGCAGACTTGATTCA
GTTGATAGAGGAGCTGAAGGGTGGAACAAGAAAGGGGAAGCCAGATGCAGGCCAAGAGCAGCCTGCAGACGGTGCCACAGAAGCCCCTCCCAGGGAACCA
GAGGTGAAGGAAAAGAGTGACCCAGAACATCAGAACGAGGTGGAAGAGGAGGACGACGATGAGGATGAAGACGATGAGGATGAACGGCAGTTGCTGGGGG
AATTTGAGAAGGAACTGGAAGGGATACTGCTCCCATCAGACCGAGACCGGCTGCGTGCCGAGGTGAAGGCTGGCATGGAGCGGGAGCTGGAGAACATCAT
CCAG---------------------CTGGACCCAGATGGGCTGAAGAAGGAGTCGGAGCGTGATCGGGCTATACTGGCCTTGACATCCACTCTCGACAAA
CTCATCAAAAGGCTAGAGGAAAAACAGAATCCAGAGCTGTTGAAGAAGCACCGGAAAAGGAGGGTTATCCCCCAAAAGCCTCCCCCGTCTCCCCAG----
-----GAGGAtgAACACAGAGTCCAGGTCCGGATCATCAAGCTCCGTCACGGAGGCCCCAATCGGGATCTGACTGTCCTCCAGATGAAACCAGAAAACCC
ACAGCTGAAACAAATCGAGGGGCTGGTGAAAGAGCTGCTGGAGAGGGAGGGACTCACAGCT------AAAATTGAGATCAAAATTGTCCAACCAGGGACG
GAAGGGACTGAAGAGGATGCACGTTGGCTGACTGATGAGGACACGAAACACCTCAAGGAGATTTTCTTCAATATCTTGGTGCAGGGAGCTGAAGAGGTGC
AGAAAGAGCGGCAGCGGCAGAAGAAGCTGGAGAGCAATTACCGCCGGGTGTGGGGCTCCCGCGACGGGGAGGGCACGGGGGACCTGGACGAATTTGACTT
CTGA


>BGISUSP0000895200
MAAETLLSSLLGLLLLGLLLPANLTGGVGSLNLEELSEMRYGIEILPLPVMGGQNQASDVVIVSSKYKQRYECRLPAGAIHFQREREEEAPAYQGPGIPE
LLSPMKDAPCLLKTKDWWTYEFCYGRHIQQYHME-SEIKGEVLYLGYYQSAFDWDDETAKASKQHRLKRYHSQTYGNGSKCDLNGRPREAEVRFLCDEGA
GISGDYIDRVDEPLSCSYVLTIRTSRLCPHPLLRPPPSTAPQAILCHPALQPEEYMAYIQRQ------------------------------------AS
PAKEDSKESDFWKMLHEPEEQAPEGEEAQAE------------------FQNNVQVKVIRSPADLIQLIEELKGGTRKGKPDAGQEQPADGATEAPPREP
EVKEKSDPEHQNEVEEEDDDEDEDDEDERQLLGEFEKELEGILLPSDRDRLRAEVKAGMERELENIIQ-------LDPDGLKKESERDRAILALTSTLDK
LIKRLEEKQNPELLKKHRKRRVIPQKPPPSPQ---EDEHRVQVRIIKLRHGGPNRDLTVLQMKPENPQLKQIEGLVKELLEREGLTA--KIEIKIVQPGT
EGTEEDARWLTDEDTKHLKEIFFNILVQGAEEVQKERQRQKKLESNYRRVWGSRDGEGTGDLDEFDF*